Cathepsin B (CTSB) Active Protein | CTSB active protein

Recombinant Human Cathepsin B (CTSB), Partial

Cat. Num. AAA7115135

• Gene Names: CTSB; APPS; CPSB; RECEUP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cathepsin B (CTSB); Recombinant Human Cathepsin B (CTSB); Partial; Cathepsin B; APP Secretase; APPS; Cathepsin B1; CTSB; CPSB; CTSB active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
• Sequence Positions: 18-339aa; Partial
• Sequence: RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
• Sequence Length: 339

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Specific activity as determined by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC is greater than 3000 pmol/min/ug
• Subcellular Location: Lysosome, Melanosome, Secreted, Extracellular Space
• Protein Families: Peptidase C1 Family
• Classification: Other Recombinant Protein
• Pathway: Apoptosis
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CTSB active protein

Relevance: Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene. Cystatin-B / CSTB is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. Cystatin-B / CSTB is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. Cystatin-B / CSTB is also thought to play a role in protecting against the proteases leaking from lysosomes.

Function: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Product Categories/Family for CTSB active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 68067549
• NCBI GeneID: 1508
• UniProt Accession #: P07858
• Molecular Weight: 36.9 kDa
• NCBI Official Full Name: Cathepsin B
• NCBI Official Synonym Full Names: cathepsin B
• NCBI Official Symbol: CTSB
• NCBI Official Synonym Symbols: APPS; CPSB; RECEUP
• NCBI Protein Information: cathepsin B
• UniProt Protein Name: Cathepsin B
• Protein Family: Cathepsin
• UniProt Gene Name: CTSB
• UniProt Synonym Gene Names: CPSB; APPS
• UniProt Entry Name: CATB_HUMAN

NCBI Description

This gene encodes a member of the C1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin B light and heavy chains, which can dimerize to form the double chain form of the enzyme. This enzyme is a lysosomal cysteine protease with both endopeptidase and exopeptidase activity that may play a role in protein turnover. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer's disease, the most common cause of dementia. Overexpression of the encoded protein has been associated with esophageal adenocarcinoma and other tumors. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Nov 2015]

Uniprot Description

CTSB: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. Dimer of a heavy chain and a light chain cross-linked by a disulfide bond. Interacts with SRPX2. Belongs to the peptidase C1 family.

Protein type: Autophagy; Motility/polarity/chemotaxis; EC 3.4.22.1; Protease

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: extracellular space; mitochondrion; intracellular membrane-bound organelle; perinuclear region of cytoplasm; lysosome; nucleolus; extracellular region; melanosome; intracellular

Molecular Function: collagen binding; peptidase activity; proteoglycan binding; protein binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: regulation of apoptosis; extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; epithelial cell differentiation; proteolysis involved in cellular protein catabolic process; regulation of catalytic activity; toll-like receptor signaling pathway; innate immune response; decidualization; proteolysis