Leucine-rich repeat-containing protein 4C (Lrrc4c) Recombinant Protein | Lrrc4c recombinant protein

Recombinant Mouse Leucine-rich repeat-containing protein 4C (Lrrc4c)

Gene Names

Lrrc4c; NGL-1; 6430556C10Rik

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Leucine-rich repeat-containing protein 4C (Lrrc4c); Recombinant Mouse Leucine-rich repeat-containing protein 4C (Lrrc4c); Lrrc4c recombinant protein

Ordering
Cat. Num. AAA7019166 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Cell Free Expression

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Liquid containing glycerol

Sequence Positions

45-640aa; full length protein

Sequence

QTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCARCNTPPNLKGRYIGEL DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIA VLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEP SQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMK TTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESH LPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI

Sequence Length

Full length protein

Application Notes

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Species

Mouse

Preparation and Storage

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Lrrc4c recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

NCBI GI #

576583456

NCBI GeneID

241568

NCBI Accession #

NP_001276671.1

NCBI GenBank Nucleotide #

NM_001289742.1

UniProt Accession #

Q8C031; Q505E5; Q8BGH8

Molecular Weight

71,992 Da

NCBI Official Full Name

leucine-rich repeat-containing protein 4C

NCBI Official Synonym Full Names

leucine rich repeat containing 4C

NCBI Official Symbol

Lrrc4c

NCBI Official Synonym Symbols

NGL-1; 6430556C10Rik

NCBI Protein Information

leucine-rich repeat-containing protein 4C

UniProt Protein Name

Leucine-rich repeat-containing protein 4C

Protein Family

Leucine-rich repeat-containing protein

UniProt Gene Name

Lrrc4c

UniProt Synonym Gene Names

Ngl1; NGL-1

UniProt Entry Name

LRC4C_MOUSE

Uniprot Description

LRRC4C: May promote neurite outgrowth of developing thalamic neurons.

Protein type: Cell development/differentiation; Membrane protein, integral

Cellular Component: cell junction; cytoplasm; extracellular space; integral to membrane; membrane; plasma membrane; postsynaptic membrane; synapse

Molecular Function: protein binding; protein kinase inhibitor activity

Biological Process: cytokine and chemokine mediated signaling pathway; negative regulation of JAK-STAT cascade; negative regulation of protein kinase activity; regulation of axonogenesis

Research Articles on Lrrc4c

1. Axonal NGL-1 transneuronally determines lamina-specific subdendritic segments.

Similar Products

Product Notes

The Lrrc4c lrrc4c (Catalog #AAA7019166) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-640aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Lrrc4c lrrc4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QTCPSVCSCS NQFSKVICVR KNLREVPDGI STNTRLLNLH ENQIQIIKVN SFKHLRHLEI LQLSRNHIRT IEIGAFNGLA NLNTLELFDN RLTTIPNGAF VYLSKLKELW LRNNPIESIP SYAFNRIPSL RRLDLGELKR LSYISEGAFE GLSNLRYLNL AMCNLREIPN LTPLIKLDEL DLSGNHLSAI RPGSFQGLMH LQKLWMIQSQ IQVIERNAFD NLQSLVEINL AHNNLTLLPH DLFTPLHHLE RIHLHHNPWN CNCDILWLSW WIRDMAPSNT ACCARCNTPP NLKGRYIGEL DQNYFTCYAP VIVEPPADLN VTEGMAAELK CRASTSLTSV SWITPNGTVM THGAYKVRIA VLSDGTLNFT NVTVQDTGMY TCMVSNSVGN TTASATLNVT AATTTPFSYF STVTVETMEP SQDEARTTDN NVGPTPVIDW ETTNVTTSLT PQSTRSTEKT FTIPVTDINS GIPGIDEVMK TTKIIIGCFV AITLMAAVML VIFYKMRKQH HRQNHHAPTR TVEIINVDDE ITGDTPMESH LPMPAIEHEH LNHYNSYKSP FNHTTTVNTI NSIHSSVHEP LLIRMNSKDN VQETQI. It is sometimes possible for the material contained within the vial of "Leucine-rich repeat-containing protein 4C (Lrrc4c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...