Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Lysyl oxidase homolog 1 (Loxl1) Recombinant Protein | Loxl1 recombinant protein

Recombinant Mouse Lysyl oxidase homolog 1 (Loxl1)

Gene Names
Loxl1; Loxl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysyl oxidase homolog 1 (Loxl1); Recombinant Mouse Lysyl oxidase homolog 1 (Loxl1); Lysyl oxidase 2; Lysyl oxidase-like protein 1; Loxl1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
95-607. Full length of the mature protein.
Sequence
RQAPSLPLPGRVGSDTVRGQTRHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSSVSASAFATTYRQPSPYPQQFPYPQ APFVNQYENYDPASRTYEQGYVYYRGAGGGMGAGAAAVASAGVIYPFQPRARYEDYGGGGGEEQPEYPAQGFYPAPERPYVPQPQPQPQPQPQPQPQPSDGLDRRYSHSLYNEGTPGFEQAYPDPSTDVSQAPAGAGGTYGGAGDPRLGWYPPYAANVPPEAYVPPRAVEPQPPFRVLEPPYLPVRSSDAPSQGGERNGAQQGRLSVGSVYRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAPEATDYDLRVLLRFPQRVKNQGTADFLPNRPRHTWEWHSCHQHYHSMDEFSHYDLLDASTGKKVAEGHKASFCLEDSTCDFGNLKRYACTSHTQGLSPGCYDTYNADIDCQWIDITDVQPGNYILKVHVNPKYIVLESDFTNNVVRCNIHYTGRYVSTTNCKIVQS
Sequence Length
607
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Loxl1 recombinant protein
Active on elastin and collagen substrates.
References
Identification of the recombinant and natural forms of mature lysyl oxidase-like 1.Seve S., Borel A., Gleyzal C., Farjanel J., Eichenberger D., Font B., Sommer P. Genetic mapping of lysyl oxidase-2 (Loxl) on mouse chromosome 9.Tchernev V.T., Yang T.P., Kingsmore S.F.Mamm. Genome 8:621-622(1997) An intron capture strategy used to identify and map a lysyl oxidase-like gene on chromosome 9 in the mouse.Wydner K.S., Kim Y., Csiszar K., Boyd C.D., Passmore H.C.Genomics 40:342-345(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58.5 kDa
NCBI Official Full Name
lysyl oxidase homolog 1
NCBI Official Synonym Full Names
lysyl oxidase-like 1
NCBI Official Symbol
Loxl1
NCBI Official Synonym Symbols
Loxl
NCBI Protein Information
lysyl oxidase homolog 1
UniProt Protein Name
Lysyl oxidase homolog 1
Protein Family
UniProt Gene Name
Loxl1
UniProt Synonym Gene Names
Lox2; Loxl
UniProt Entry Name
LOXL1_MOUSE

NCBI Description

This gene encodes a member of the lysyl oxidase family of copper-dependent enzymes that catalyze the formation of lysine-derived crosslinks in proteins such as collagen and elastin. The encoded preproprotein undergoes proteolytic processing to generate the mature, functional enzyme. Mice lacking the encoded protein fail to deposit normal elastic fibers in the uterine tract post partum and develop pelvic organ prolapse, enlarged airspaces of the lung, loose skin and vascular abnormalities with concomitant tropoelastin accumulation. [provided by RefSeq, Sep 2016]

Uniprot Description

LOXL1: Active on elastin and collagen substrates. Genetic variations in LOXL1 are a cause of susceptibility to exfoliation syndrome (XFS); also called exfoliation glaucoma (XFG). XFS is a disorder characterized by accumulation of abnormal fibrillar deposits in the anterior segment of the eye. In addition to being a cause of glaucoma and glaucomatous optic neuropathy, exfoliation syndrome has also been associated with lens zonule weakness, cataract formation, and systemic vascular complications due to deposition of exfoliation material in extraocular tissues. Susceptibility to exfoliation syndrome is conferred by a risk haplotype that includes two LOXL1 coding non-synonymous SNPs (Arg141Leu and Gly153Asp) and one intronic SNP. Arg141Leu and Gly153Asp are sufficient to confer disease susceptibility in some populations. Belongs to the lysyl oxidase family.

Protein type: Extracellular matrix; Secreted, signal peptide; EC 1.4.3.-; Oxidoreductase; Secreted

Cellular Component: acrosome; basement membrane; cytoplasm; extracellular matrix; extracellular region; proteinaceous extracellular matrix

Molecular Function: aspartate oxidase activity; copper ion binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor; protein binding

Research Articles on Loxl1

Similar Products

Product Notes

The Loxl1 loxl1 (Catalog #AAA963165) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 95-607. Full length of the mature protein. The amino acid sequence is listed below: RQAPSLPLPG RVGSDTVRGQ TRHPFGFGQV PDNWREVAVG DSTGMARART SVSQQRHGGS ASSSVSASAF ATTYRQPSPY PQQFPYPQ APFVNQYENY DPASRTYEQG YVYYRGAGGG MGAGAAAVAS AGVIYPFQPR ARYEDYGGGG GEEQPEYPAQ GFYPAPERPY VPQPQPQPQP QPQPQPQPSD GLDRRYSHSL YNEGTPGFEQ AYPDPSTDVS QAPAGAGGTY GGAGDPRLGW YPPYAANVPP EAYVPPRAVE PQPPFRVLEP PYLPVRSSDA PSQGGERNGA QQGRLSVGSV YRPNQNGRGL PDLVPDPNYV QASTYVQRAH LYSLRCAAEE KCLASTAYAP EATDYDLRVL LRFPQRVKNQ GTADFLPNRP RHTWEWHSCH QHYHSMDEFS HYDLLDASTG KKVAEGHKAS FCLEDSTCDF GNLKRYACTS HTQGLSPGCY DTYNADIDCQ WIDITDVQPG NYILKVHVNP KYIVLESDFT NNVVRCNIHY TGRYVSTTNC KIVQS . It is sometimes possible for the material contained within the vial of "Lysyl oxidase homolog 1 (Loxl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.