Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Leukotoxin (lktA), partial Recombinant Protein | lktA recombinant protein

Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (lktA), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukotoxin (lktA); partial; Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (lktA); Recombinant Leukotoxin (lktA); Leukotoxin; Lkt; lktA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
721-1055aa; Partial
Sequence
IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNKKTISPQELAGLIKNKGKSSSLMSSSRSSSMLTQKSGLSNDISRIISATSGFGSSGKALSASPLQTNNNFNSYANSLATTA
Sequence Length
1055
Species
Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans)
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
38.3 kDa
NCBI Official Full Name
Leukotoxin
UniProt Protein Name
Leukotoxin
Protein Family
UniProt Gene Name
lktA
UniProt Synonym Gene Names
lta; Lkt
UniProt Entry Name
LKTA_AGGAC

Uniprot Description

Function: One of the virulence factors of A.actinomycetemcomitans might be a cytotoxin, possibly the membrane-bound hemolysin.

Subcellular location: Cell outer membrane; Multi-pass membrane protein

By similarity. Secreted

By similarity.

Domain: The Gly-rich region is probably involved in binding calcium, which is required for target cell-binding or cytolytic activity.The three transmembrane domains are believed to be involved in pore formation by the cytotoxin

By similarity.

Post-translational modification: Palmitoylated by LktC. The toxin only becomes active when modified

By similarity.

Miscellaneous: Its target cell specificity is restricted to human and some non-human cells of the monomyelocytic lineage.

Sequence similarities: Belongs to the RTX prokaryotic toxin (TC 1.C.11) family. [View classification]Contains 7 hemolysin-type calcium-binding repeats.

Similar Products

Product Notes

The Leukotoxin (lktA), partial lkta (Catalog #AAA1086043) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 721-1055aa; Partial. The amino acid sequence is listed below: IGSTLRDKFY GSKFNDVFHG HDGDDLIYGY DGDDRLYGDN GNDEIHGGQG NDKLYGGAGN DRLFGEYGNN YLDGGEGDDH LEGGNGSDIL RGGSGNDKLF GNQGDDLLDG GEGDDQLAGG EGNDIYVYRK EYGHHTITEH SGDKDKLSLA NINLKDVSFE RNGNDLLLKT NNRTAVTFKG WFSKPNSSAG LDEYQRKLLE YAPEKDRARL KRQFELQRGK VDKSLNNKVE EIIGKDGERI TSQDIDNLFD KSGNKKTISP QELAGLIKNK GKSSSLMSSS RSSSMLTQKS GLSNDISRII SATSGFGSSG KALSASPLQT NNNFNSYANS LATTA. It is sometimes possible for the material contained within the vial of "Leukotoxin (lktA), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.