Leukemia inhibitory factor (Lif) Recombinant Protein | Lif recombinant protein

Recombinant Rat Leukemia inhibitory factor (Lif)

Cat. Num. AAA718705

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Leukemia inhibitory factor (Lif); Recombinant Rat Leukemia inhibitory factor (Lif); Lif recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 23-202, Full length protein
• Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF
• Sequence Length: 180

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Lif recombinant protein

This protein is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface.

NCBI and Uniprot Product Information

• NCBI GI #: 126281
• NCBI GeneID: 60584
• UniProt Accession #: P17777
• Molecular Weight: 22,113 Da
• NCBI Official Full Name: Leukemia inhibitory factor
• NCBI Official Synonym Full Names: LIF, interleukin 6 family cytokine
• NCBI Official Symbol: Lif
• NCBI Protein Information: leukemia inhibitory factor
• UniProt Protein Name: Leukemia inhibitory factor
• Protein Family: Leukemia inhibitory factor
• UniProt Gene Name: Lif
• UniProt Synonym Gene Names: LIF

NCBI Description

a secreted cytokine; involved in embryonic stem cell and myeloid cell growth and differentiation and stimulation of bone remodeling [RGD, Feb 2006]

Uniprot Description

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.