Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human LIF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 33-45kDa.)

LIF active protein

Recombinant Human LIF Protein

Gene Names
LIF; CDF; DIA; HILDA; MLPLI
Purity
>95% by SDS-PAGE.
Synonyms
LIF; Recombinant Human LIF Protein; CDF; DIA; HILDA; MLPLI; LIF active protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Sequence Length
202
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells.The ED50 for this effect is typically 0.1-0.3 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human LIF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 33-45kDa.)

SDS-Page (Recombinant Human LIF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 33-45kDa.)
Related Product Information for LIF active protein
Description: Recombinant Human LIF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser23-Phe202) of human LIF (Accession #NP_002300.1) fused with a 6xHis tag at the C-terminus.

Background: The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for LIF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
leukemia inhibitory factor isoform 1
NCBI Official Synonym Full Names
LIF interleukin 6 family cytokine
NCBI Official Symbol
LIF
NCBI Official Synonym Symbols
CDF; DIA; HILDA; MLPLI
NCBI Protein Information
leukemia inhibitory factor
UniProt Protein Name
Leukemia inhibitory factor
UniProt Gene Name
LIF
UniProt Synonym Gene Names
HILDA; LIF; D factor; MLPLI
UniProt Entry Name
LIF_HUMAN

NCBI Description

The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

LIF: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. Belongs to the LIF/OSM family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: growth factor activity; leukemia inhibitory factor receptor binding; cytokine activity; receptor binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of hormone secretion; multicellular organismal development; leukemia inhibitory factor signaling pathway; stem cell maintenance; tyrosine phosphorylation of Stat3 protein; decidualization; positive regulation of peptidyl-serine phosphorylation; positive regulation of tyrosine phosphorylation of Stat3 protein; negative regulation of cell proliferation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; negative regulation of meiosis; positive regulation of cell proliferation; neuron development; blood vessel remodeling; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of macrophage differentiation; muscle morphogenesis; alveolus development; embryo implantation; positive regulation of peptidyl-serine phosphorylation of STAT protein; positive regulation of astrocyte differentiation

Research Articles on LIF

Similar Products

Product Notes

The LIF lif (Catalog #AAA9139688) is an Active Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SPLPITPVNA TCAIRHPCHN NLMNQIRSQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKAKL VELYRIVVYL GTSLGNITRD QKILNPSALS LHSKLNATAD ILRGLLSNVL CRLCSKYHVG HVDVTYGPDT SGKDVFQKKK LGCQLLGKYK QIIAVLAQAF. It is sometimes possible for the material contained within the vial of "LIF, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.