SDS-PAGE
Galectin-7 Recombinant Protein | Lgals7 recombinant protein
Recombinant Mouse Galectin-7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Galectin-7; Recombinant Mouse Galectin-7; Lgals7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-136aa; Full Length
Sequence
SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF
Sequence Length
136
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Lgals7 recombinant protein
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
References
Galectin-7, a marker of all types of stratified epithelia.Magnaldo T., Fowlis D., Darmon M.Differentiation 63:159-168(1998)
NCBI and Uniprot Product Information
Uniprot Description
LGALS7B: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
Protein type: Cell adhesion; Apoptosis
Cellular Component: cytoplasm; extracellular region; extracellular space; nucleus
Molecular Function: carbohydrate binding
Biological Process: apoptosis; heterophilic cell adhesion
Similar Products
Product Notes
The Lgals7 lgals7 (Catalog #AAA1026643) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-136aa; Full Length. The amino acid sequence is listed below: SATHHKTSLP QGVRVGTVMR IRGLVPDQAG RFHVNLLCGE EQGADAALHF NPRLDTSEVV FNTKQQGKWG REERGTGIPF QRGQPFEVLL IATEEGFKAV VGDDEYLHFH HRLPPARVRL VEVGGDVQLH SLNIF. It is sometimes possible for the material contained within the vial of "Galectin-7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
