LexA repressor Recombinant Protein | lexA recombinant protein

Recombinant Escherichia coli (strain K12) LexA repressor

Cat. Num. AAA1108189

• Gene Names: lexA; ECK4035; exrA; JW4003; spr; tsl; umuA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: LexA repressor; Recombinant Escherichia coli (strain K12) LexA repressor; Escherichia coli (strain K12); lexA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-202aa; Full Length
• Sequence: MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL
• Sequence Length: 202

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for lexA recombinant protein

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment. The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA

Product Categories/Family for lexA recombinant protein

Microbiology

References

"Purified lexA protein is a repressor of the recA and lexA genes." Little J.W., Mount D.W., Yanisch-Perron C.R. Proc. Natl. Acad. Sci. U.S.A. 78:4199-4203(1981)

NCBI and Uniprot Product Information

• NCBI GI #: 16131869
• NCBI GeneID: 948544
• NCBI Accession #: NP_418467.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0A7C2; P03033; Q2M6R1
• Molecular Weight: 38.4 kDa
• NCBI Official Full Name: transcriptional repressor of SOS regulon
• NCBI Official Symbol: lexA
• NCBI Official Synonym Symbols: ECK4035; exrA; JW4003; spr; tsl; umuA
• NCBI Protein Information: transcriptional repressor of SOS regulon
• UniProt Protein Name: LexA repressor
• Protein Family: LexA repressor
• UniProt Gene Name: lexA
• UniProt Entry Name: LEXA_ECOLI

NCBI Description

LexA autocleavage, stimulated by RecA, of the first 84 aa of LexA removes the DNA binding region and is required to activate the SOS response. [More information is available at EcoGene: EG10533]. LexA is a protein that belongs to the LexA family . [More information is available at EcoCyc: EG10533].

Uniprot Description

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment (PubMed:20005847).The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA (PubMed:22412352).