CD158k recombinant protein

CD158k Recombinant Protein

Cat. Num. AAA3004089

• Gene Names: KIR3DL2; 3DL2; p140; NKAT4; CD158K; NKAT-4; NKAT4B; KIR-3DL2
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD158k; CD158k Recombinant Protein; CD158k recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 969
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD158k recombinant protein

Background: The killer immunoglobulin-like receptors (KIRs) on natural killer (NK) cells regulate the inhibition and activation of NK-cell responses through recognition of human leukocyte antigen (HLA) class I molecules. KIR3DL1, a receptor for HLA-B antigens with the Bw4 allele, transmits an inhibitory signal to prevent killer cell-mediated cytoxicity. KIR3DL1 encodes a 444 amino acid type I transmembrane protein, containing 3 immunoglobulin-like C2-type domains. Human KIR3DL1 maps to chromosome 19q13.4.

NCBI and Uniprot Product Information

• NCBI GI #: 1171729
• NCBI GeneID: 3812
• UniProt Accession #: P43630; Q13238; Q14947; Q14948; Q92684; Q95366; Q95367; Q95368
• Molecular Weight: 48,517 Da
• NCBI Official Full Name: Killer cell immunoglobulin-like receptor 3DL2
• NCBI Official Synonym Full Names: killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
• NCBI Official Symbol: KIR3DL2
• NCBI Official Synonym Symbols: 3DL2; p140; NKAT4; CD158K; NKAT-4; NKAT4B; KIR-3DL2
• NCBI Protein Information: killer cell immunoglobulin-like receptor 3DL2
• UniProt Protein Name: Killer cell immunoglobulin-like receptor 3DL2
• UniProt Gene Name: KIR3DL2
• UniProt Synonym Gene Names: CD158K; NKAT4; NKAT-4; p70 NK receptor CL-5

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

Receptor on natural killer (NK) cells for HLA-A alleles. Inhibits the activity of NK cells thus preventing cell lysis.