Mouse GIT2 Monoclonal Antibody | anti-GIT2 antibody

GIT2 (G Protein-Coupled Receptor Kinase Interacting ArfGAP 2, CAT-2, DKFZp686G01261, KIAA0148, MGC760) (HRP)

Cat. Num. AAA6182529

• Gene Names: GIT2; PKL; CAT2; CAT-2
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: GIT2; Monoclonal Antibody; GIT2 (G Protein-Coupled Receptor Kinase Interacting ArfGAP 2; CAT-2; DKFZp686G01261; KIAA0148; MGC760) (HRP); G Protein-Coupled Receptor Kinase Interacting ArfGAP 2; MGC760; anti-GIT2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B2
• Specificity: Recognizes GIT2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 679

• Applicable Applications for anti-GIT2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GIT2 (NP_055591, 401aa-498aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GIT2 expression in transfected 293T cell line by GIT2 monoclonal antibody (M04), clone 1B2.Lane 1: GIT2 transfected lysate (Predicted MW: 52.6 KDa).Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-GIT2 antibody

Antibodies; G Protein Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 21237786
• NCBI GeneID: 9815
• NCBI Accession #: NP_055591
• NCBI GenBank Nucleotide #: NP_055591.2
• UniProt Accession #: Q14161
• NCBI Official Full Name: ARF GTPase-activating protein GIT2 isoform 3
• NCBI Official Synonym Full Names: GIT ArfGAP 2
• NCBI Official Symbol: GIT2
• NCBI Official Synonym Symbols: PKL; CAT2; CAT-2
• NCBI Protein Information: ARF GTPase-activating protein GIT2
• UniProt Protein Name: ARF GTPase-activating protein GIT2
• Protein Family: ARF GTPase-activating protein
• UniProt Gene Name: GIT2
• UniProt Synonym Gene Names: KIAA0148; ARF GAP GIT2; CAT-2; CAT2
• UniProt Entry Name: GIT2_HUMAN

NCBI Description

This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding. [provided by RefSeq, Sep 2008]

Uniprot Description

GIT2: possesses ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. Interacts with G protein-coupled receptor kinases. Associates with paxillin. Also interacts with PIX exchange factors. Regulates Golgi and actin cytoskeletal organization. Important in integrin-mediated cell adhesion. Ten alternatively spliced isoforms have been described and additional isoforms seem to exist. Contains 1 Arf-GAP domain and 3 ANK repeats.

Protein type: GAPs, ARF; Motility/polarity/chemotaxis; GAPs

Chromosomal Location of Human Ortholog: 12q24.1

Cellular Component: nucleoplasm; focal adhesion

Molecular Function: protein binding; zinc ion binding

Biological Process: behavioral response to pain; regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity