Potassium channel subfamily K member 9 (KCNK9) Recombinant Protein | KCNK9 recombinant protein

Recombinant Human Potassium channel subfamily K member 9 (KCNK9)

Cat. Num. AAA7017753

• Gene Names: KCNK9; KT3.2; TASK3; K2p9.1; TASK-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium channel subfamily K member 9 (KCNK9); Recombinant Human Potassium channel subfamily K member 9 (KCNK9); KCNK9 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-374aa; full length protein
• Sequence: MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS FTDHQRLMKRRKSV
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for KCNK9 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 542133161
• NCBI GeneID: 51305
• NCBI Accession #: NP_001269463.1
• NCBI GenBank Nucleotide #: NM_001282534.1
• UniProt Accession #: Q9NPC2; Q2M290; Q540F2
• Molecular Weight: 42,264 Da
• NCBI Official Full Name: potassium channel subfamily K member 9
• NCBI Official Synonym Full Names: potassium two pore domain channel subfamily K member 9
• NCBI Official Symbol: KCNK9
• NCBI Official Synonym Symbols: KT3.2; TASK3; K2p9.1; TASK-3
• NCBI Protein Information: potassium channel subfamily K member 9
• UniProt Protein Name: Potassium channel subfamily K member 9
• Protein Family: Potassium channel subfamily
• UniProt Gene Name: KCNK9
• UniProt Synonym Gene Names: TASK3; Two pore K(+) channel KT3.2
• UniProt Entry Name: KCNK9_HUMAN

NCBI Description

This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel mental retardation dysmorphism syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

KCNK9: pH-dependent, voltage-insensitive, background potassium channel protein. Mainly found in the cerebellum. Also found in adrenal gland, kidney and lung. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: integral to plasma membrane; plasma membrane; synaptic vesicle

Molecular Function: potassium channel activity; potassium ion leak channel activity; protein heterodimerization activity; protein homodimerization activity; voltage-gated potassium channel activity

Biological Process: potassium ion transport; stabilization of membrane potential

Disease: Birk-barel Mental Retardation Dysmorphism Syndrome