Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Integrin beta-1 (Itgb1) Recombinant Protein | Itgb1 recombinant protein

Recombinant Mouse Integrin beta-1 (Itgb1), partial

Gene Names
Itgb1; CD29; Fnrb; gpIIa; Gm9863; AA409975; AA960159; 4633401G24Rik; ENSMUSG00000051907
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin beta-1 (Itgb1); Recombinant Mouse Integrin beta-1 (Itgb1); partial; Fibronectin receptor subunit beta; VLA-4 subunit beta; CD_antigen: CD29; Itgb1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-728. Extracellular domain
Sequence
QTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPTSARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTGPCLASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDTCAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDD CWFYFTYSVNGNNEAIVHVVETPDCPTGPD
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Itgb1 recombinant protein
Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G-E-R in collagen. Integrins alpha-2/beta-1, alpha-3/beta-1, alpha-4/beta-1, alpha-5/beta-1, alpha-8/beta-1, alpha-10/beta-1, alpha-11/beta-1 and alpha-V/beta-1 are receptors for fibronectin. Alpha-4/beta-1 recognizes one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. Integrin alpha-5/beta-1 is a receptor for fibrinogen. Integrin alpha-1/beta-1, alpha-2/beta-1, alpha-6/beta-1 and alpha-7/beta-1 are receptors for lamimin. Integrin alpha-4/beta-1 is a receptor for VCAM1 and recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-9/beta-1 is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. Integrin alpha-3/beta-1 is a receptor for epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. Integrin alpha-V/beta-1 is a receptor for vitronectin. Beta-1 integrins recognize the sequence R-G-D in a wide array of ligands. When associated with alpha-7/beta-1 integrin, regulates cell adhesion and laminin matrix deposition. Involved in promoting endothelial cell motility and angiogenesis. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process and the formation of mineralized bone nodules. May be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and GNB2L1, serves as a platform for SRC activation or inactivation. Plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.
Product Categories/Family for Itgb1 recombinant protein
References
"Murine mRNA for the beta-subunit of integrin is increased in BALB/c-3T3 cells entering the G1 phase from the G0 state." Tominaga S. FEBS Lett. 238:315-319(1988)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82.2 kDa
NCBI Official Full Name
integrin beta-1
NCBI Official Synonym Full Names
integrin beta 1 (fibronectin receptor beta)
NCBI Official Symbol
Itgb1
NCBI Official Synonym Symbols
CD29; Fnrb; gpIIa; Gm9863; AA409975; AA960159; 4633401G24Rik; ENSMUSG00000051907
NCBI Protein Information
integrin beta-1
UniProt Protein Name
Integrin beta-1
Protein Family
UniProt Gene Name
Itgb1
UniProt Entry Name
ITB1_MOUSE

Uniprot Description

ITGB1: an integral membrane protein that heterodimerizes with an alpha-3 chain, forming a receptor for many extracellular-matrix proteins including fibronectin, laminin, collagen, epiligrin and thrombospondin. . Beta 1 integrins recognize the amino-acid motif RGD in a wide array of ligands. Five alternatively spliced variants with alternate carboxy termini have been described. Two alternatively spliced isoforms have been described. Isoform beta-1a is widely expressed; other isoforms are generally expressed with a more restricted distribution. Isoform beta-1b is expressed in skin, liver, skeletal muscle, cardiac muscle, placenta, umbilical vein endothelial cells, neuroblastoma cells, lymphoma cells, hepatoma cells and astrocytoma cells. Isoforms beta-1c and beta-1c-2 are expressed in muscle, kidney, liver, placenta, cervical epithelium, umbilical vein endothelial cells, fibroblast cells, embryonal kidney cells, platelets and several blood cell lines. Isoform beta-c-2, rather than isoform beta-1c, is selectively expressed in primary t-cells. Isoform beta-1c is expressed in nonproliferating and differentiated prostate gland epithelial cells. Isoform beta-1d is expressed specifically in striated muscle (skeletal and cardiac muscle).

Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, misc.; Cell surface

Cellular Component: acrosome; adherens junction; basement membrane; cell junction; cell projection; cell surface; cytoplasm; cytoplasmic vesicle; dendritic spine; endosome; external side of plasma membrane; filopodium; focal adhesion; hemidesmosome; integral to membrane; integrin complex; intercellular junction; lipid raft; membrane; neuromuscular junction; perinuclear region of cytoplasm; plasma membrane; receptor complex; sarcolemma; synapse

Molecular Function: actin binding; alpha-actinin binding; cell adhesion molecule binding; collagen binding; fibronectin binding; glycoprotein binding; integrin binding; kinase binding; laminin binding; metal ion binding; peptide binding; protease binding; protein binding; protein complex binding; protein domain specific binding; protein heterodimerization activity; protein kinase binding; receptor activity; receptor binding

Biological Process: axon extension; calcium-independent cell-matrix adhesion; cardiac muscle cell differentiation; cardiac muscle development; cell adhesion; cell fate specification; cell migration; cell migration during sprouting angiogenesis; cell-matrix adhesion; cell-substrate adhesion; cellular calcium ion homeostasis; dendrite morphogenesis; formation of radial glial scaffolds; G1/S transition of mitotic cell cycle; germ cell migration; heterotypic cell-cell adhesion; in utero embryonic development; integrin-mediated signaling pathway; leukocyte adhesion; leukocyte tethering or rolling; negative regulation of cell differentiation; negative regulation of cell projection organization and biogenesis; negative regulation of cell proliferation; negative regulation of neuron differentiation; negative regulation of Rho protein signal transduction; neurite development; positive regulation of apoptosis; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of endocytosis; positive regulation of GTPase activity; positive regulation of MAPKKK cascade; positive regulation of neuron differentiation; positive regulation of peptidyl-tyrosine phosphorylation; protein transport within lipid bilayer; receptor internalization; regulation of cell cycle; regulation of G-protein coupled receptor protein signaling pathway; sarcomere organization; stress fiber formation; tissue homeostasis; transforming growth factor beta receptor signaling pathway; visual learning

Research Articles on Itgb1

Similar Products

Product Notes

The Itgb1 itgb1 (Catalog #AAA950143) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-728. Extracellular domain. The amino acid sequence is listed below: QTDKNRCLKA NAKSCGECIQ AGPNCGWCTN TTFLQEGMPT SARCDDLEAL KKKGCQPSDI ENPRGSQTIK KNKNVTNRSK GMAEKLRPED ITQIQPQQLL LKLRSGEPQK FTLKFKRAED YPIDLYYLMD LSYSMKDDLE NVKSLGTDLM NEMRRITSDF RIGFGSFVEK TVMPYISTTP AKLRNPCTSE QNCTSPFSYK NVLSLTDRGE FFNELVGQQR ISGNLDSPEG GFDAIMQVAV CGSLIGWRNV TRLLVFSTDA GFHFAGDGKL GGIVLPNDGQ CHLENNVYTM SHYYDYPSIA HLVQKLSENN IQTIFAVTEE FQPVYKELKN LIPKSAVGTL SGNSSNVIQL IIDAYNSLSS EVILENSKLP DGVTINYKSY CKNGVNGTGE NGRKCSNISI GDEVQFEISI TANKCPNKES ETIKIKPLGF TEEVEVVLQF ICKCNCQSHG IPASPKCHEG NGTFECGACR CNEGRVGRHC ECSTDEVNSE DMDAYCRKEN SSEICSNNGE CVCGQCVCRK RDNTNEIYSG KFCECDNFNC DRSNGLICGG NGVCRCRVCE CYPNYTGSAC DCSLDTGPCL ASNGQICNGR GICECGACKC TDPKFQGPTC ETCQTCLGVC AEHKECVQCR AFNKGEKKDT CAQECSHFNL TKVESREKLP QPVQVDPVTH CKEKDIDD CWFYFTYSVN GNNEAIVHVV ETPDCPTGPD . It is sometimes possible for the material contained within the vial of "Integrin beta-1 (Itgb1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.