Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Integrin alpha-M (ITGAM) Recombinant Protein | ITGAM recombinant protein

Recombinant Guinea pig Integrin alpha-M (ITGAM)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin alpha-M (ITGAM); Recombinant Guinea pig Integrin alpha-M (ITGAM); ITGAM recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-126, Full length protein
Sequence
QLELPVKYAVYLIVTSGEASTTYLNFTTSEKTIQTMKHQYKFTNLGKRSLPISVVFWVPVRLNNEIVWDRPQVTFSPNLSSACNTEERSPPHSDFLAELEKTHVLNCSIAVCQRIACDIPYFNIQE
Sequence Length
126
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ITGAM recombinant protein
This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ( Mac-1 ), or inactivated-C3b (iC3b) receptor 3 ( CR3 ). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
14,411 Da
NCBI Official Full Name
Integrin alpha-M
UniProt Protein Name
Integrin alpha-M
Protein Family
UniProt Gene Name
ITGAM

Uniprot Description

Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles. It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration. In assocciation with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. May regulate phagocytosis-induced apoptosis in extravasated neutrophils. May play a role in mast cell development.

Similar Products

Product Notes

The ITGAM itgam (Catalog #AAA959046) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-126, Full length protein. The amino acid sequence is listed below: QLELPVKYAV YLIVTSGEAS TTYLNFTTSE KTIQTMKHQY KFTNLGKRSL PISVVFWVPV RLNNEIVWDR PQVTFSPNLS SACNTEERSP PHSDFLAELE KTHVLNCSIA VCQRIACDIP YFNIQE. It is sometimes possible for the material contained within the vial of "Integrin alpha-M (ITGAM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.