Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITGAMSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ITGAM Polyclonal Antibody | anti-ITGAM antibody

ITGAM Antibody - C-terminal region

Gene Names
ITGAM; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ITGAM; Polyclonal Antibody; ITGAM Antibody - C-terminal region; anti-ITGAM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: PFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDMMSEGGPPG
Sequence Length
1152
Applicable Applications for anti-ITGAM antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ITGAM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITGAMSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITGAMSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ITGAM antibody
This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ITGAM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126 kDa
NCBI Official Full Name
integrin alpha-M isoform 2
NCBI Official Synonym Full Names
integrin subunit alpha M
NCBI Official Symbol
ITGAM
NCBI Official Synonym Symbols
CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6
NCBI Protein Information
integrin alpha-M
UniProt Protein Name
Integrin alpha-M
Protein Family
UniProt Gene Name
ITGAM
UniProt Synonym Gene Names
CD11B; CR3A
UniProt Entry Name
ITAM_HUMAN

NCBI Description

This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

ITGAM: a single-pass type I membrane protein of the integrin alpha chain family. Implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles. Also known as CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the RGD peptide in C3b. A receptor for fibrinogen, factor X and ICAM1. Heterodimer of an alpha and a beta subunit. Alpha-M associates with beta-2. Predominantly expressed in monocytes and granulocytes.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cell surface; plasma membrane; integrin complex; nucleus; external side of plasma membrane

Molecular Function: heparan sulfate proteoglycan binding; heparin binding; protein binding; opsonin binding; protein heterodimerization activity; metal ion binding; glycoprotein binding

Biological Process: integrin-mediated signaling pathway; neutrophil chemotaxis; extracellular matrix organization and biogenesis; microglia development; activated T cell proliferation; leukocyte migration during inflammatory response; cellular extravasation; toll-like receptor signaling pathway; innate immune response; cell adhesion; blood coagulation; toll-like receptor 4 signaling pathway; leukocyte migration

Disease: Systemic Lupus Erythematosus, Susceptibility To, 6

Research Articles on ITGAM

Similar Products

Product Notes

The ITGAM itgam (Catalog #AAA3220739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGAM Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGAM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGAM itgam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFEVPNPLPL IVGSSVGGLL LLALITAALY KLGFFKRQYK DMMSEGGPPG. It is sometimes possible for the material contained within the vial of "ITGAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.