Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Integrin alpha-IIb (Itga2b) Recombinant Protein | Itga2b recombinant protein

Recombinant Mouse Integrin alpha-IIb (Itga2b) , partial

Gene Names
Itga2b; CD41; CD41B; GpIIb; AI172977; alphaIIb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin alpha-IIb (Itga2b); Recombinant Mouse Integrin alpha-IIb (Itga2b); partial; Itga2b recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
638-883. Partial.
Sequence
CVPQLRLTATAGDSPLLIGADNVLELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQKKENESRVALCELGNPMKKDTRIGITMLVSVENLEEAGESVSFQLQVRSKNSQNPNSKVVMLPVAIQAEATVELRGNSFPASLVVAAEEGDREQEDLDRWVSRLEHTYELHNIGPGTVNGLRLLIHIPGQSQPSDLLYILDVQPQGGLLCSTQPSPKVDWKLSTPSPSSIRPVHHQR
Sequence Length
883
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Itga2b recombinant protein
ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112,678 Da
NCBI Official Full Name
integrin alpha-IIb
NCBI Official Synonym Full Names
integrin alpha 2b
NCBI Official Symbol
Itga2b
NCBI Official Synonym Symbols
CD41; CD41B; GpIIb; AI172977; alphaIIb
NCBI Protein Information
integrin alpha-IIb
UniProt Protein Name
Integrin alpha-IIb
Protein Family
UniProt Gene Name
Itga2b
UniProt Synonym Gene Names
GPIIb

Uniprot Description

Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.

Research Articles on Itga2b

Similar Products

Product Notes

The Itga2b itga2b (Catalog #AAA1432753) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 638-883. Partial. The amino acid sequence is listed below: CVPQLRLTAT AGDSPLLIGA DNVLELKIEA ANDGEGAYEA ELAVHLPPGA HYMRALSNIE GFERLVCTQK KENESRVALC ELGNPMKKDT RIGITMLVSV ENLEEAGESV SFQLQVRSKN SQNPNSKVVM LPVAIQAEAT VELRGNSFPA SLVVAAEEGD REQEDLDRWV SRLEHTYELH NIGPGTVNGL RLLIHIPGQS QPSDLLYILD VQPQGGLLCS TQPSPKVDWK LSTPSPSSIR PVHHQR . It is sometimes possible for the material contained within the vial of "Integrin alpha-IIb (Itga2b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.