Western Blot (WB)
(WB Suggested Anti-ITGA2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Rabbit ITGA2B Polyclonal Antibody | anti-ITGA2B antibody
ITGA2B antibody - N-terminal region
Gene Names
ITGA2B; GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITGA2B; Polyclonal Antibody; ITGA2B antibody - N-terminal region; anti-ITGA2B antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRR
Sequence Length
1039
Applicable Applications for anti-ITGA2B antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 85%; Rat: 92%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ITGA2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Western Blot (WB)
(WB Suggested Anti-ITGA2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-ITGA2B antibody
This is a rabbit polyclonal antibody against ITGA2B. It was validated on Western Blot
Target Description: ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
Target Description: ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
Product Categories/Family for anti-ITGA2B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
integrin alpha-IIb preproprotein
NCBI Official Synonym Full Names
integrin subunit alpha 2b
NCBI Official Symbol
ITGA2B
NCBI Official Synonym Symbols
GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93
NCBI Protein Information
integrin alpha-IIb
UniProt Protein Name
Integrin alpha-IIb
Protein Family
UniProt Gene Name
ITGA2B
UniProt Synonym Gene Names
GP2B; ITGAB; GPIIb
UniProt Entry Name
ITA2B_HUMAN
NCBI Description
This gene encodes a member of the integrin alpha chain family of proteins. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate through disulfide linkages to form a subunit of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system, by mediating platelet aggregation. Mutations in this gene are associated with platelet-type bleeding disorders, which are characterized by a failure of platelet aggregation, including Glanzmann thrombasthenia. [provided by RefSeq, Jan 2016]
Research Articles on ITGA2B
Similar Products
Product Notes
The ITGA2B itga2b (Catalog #AAA3216236) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGA2B antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGA2B itga2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QGLGASVVSW SDVIVACAPW QHWNVLEKTE EAEKTPVGSC FLAQPESGRR. It is sometimes possible for the material contained within the vial of "ITGA2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
