Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Beta-insect excitatory toxin LqqIT1 Recombinant Protein | Insect toxin 1 recombinant protein

Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-insect excitatory toxin LqqIT1; Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1; Insect toxin 1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-70. Full Length
Sequence
KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN
Species
Leiurus quinquestriatus quinquestriatus (Egyptian scorpion)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
11.7
NCBI Official Full Name
Beta-insect excitatory toxin LqqIT1
UniProt Protein Name
Beta-insect excitatory toxin LqqIT1
UniProt Gene Name
Insect toxin 1
UniProt Synonym Gene Names
LqqIT1'

Uniprot Description

Excitatory insect beta-toxins induce a spastic paralysis. They bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin induces a fast excitatory contraction paralysis on fly larvae. It is active only on insects.

Similar Products

Product Notes

The Beta-insect excitatory toxin LqqIT1 insect toxin 1 (Catalog #AAA1135721) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-70. Full Length. The amino acid sequence is listed below: KKNGYAVDSS GKAPECLLSN YCYNECTKVH YADKGYCCLL SCYCVGLSDD KKVLEISDAR KKYCDFVTIN. It is sometimes possible for the material contained within the vial of "Beta-insect excitatory toxin LqqIT1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual