PlGF active protein

Rat PlGF

Cat. Num. AAA691573

• Gene Names: Pgf; Plgf
• Reactivity: Rat
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: PlGF; Rat PlGF; Recombinant Rat Placenta Growth Factor; Placenta Growth Factor; PlGF active protein

• Host: Insect Cells
• Reactivity: Rat
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Freeze dried; 25 mM Tris, pH 8.5
• Sequence: ALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTQTEEPHL
• Sequence Length: 135

• N Terminal Sequence: ALSAGNNSTEMEV
• Reconstitution: The rat PlGF is supplied in lyophilized form and can be reconstituted with water. This solution can be diluted into other buffered solutions or stored frozen for future use.
• Biological Activity: Measured by its ability to bind recombinant human sFlt-1 in a functional ELISA. Recombinant human sFlt-1 can bind to immobilized recombinant rat PlGF (50ng/well) with a linear range at 0.1 - 5ng/mL
• Preparation and Storage: The lyophilized rat PIGF, though stable at room temperature, is best stored in working aliquots at -20 degree C to -70 degree C. Avoid repeated freeze and thaw cycles.

Testing Data

Testing Data #2

Related Product Information for PlGF active protein

Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse and rat tissues, only one PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Rat PlGF shares about 60% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to rat chromosome 6. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
However, little information regarding the expression pattern and cellular localization of PlGF mRNA in rat placenta during pregnancy is known. RT-PCR analysis shows that the expression level of PlGF mRNA increased as gestation advanced. Using in situ hybridization histochemistry, positive cells of PlGF mRNA were detected in chorionic villi, in the trophoblast and stroma cells surrounding the blood vessels within chorionic villi on day 13 and 15. The expression pattern of PlGF mRNA in rat placenta during pregnancy demonstrates that PlGF plays a functional role for placental growth and fetal development during mid-late pregnancy.
The full ORF of rat PlGF (Met1-Leu158) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols. The native protein expressed in insect cells starts with Ala24.

Product Categories/Family for PlGF active protein

Cytokines & Growth Factors

References

1. Osol G et al, Am J Physiol Heart Circ Physiol 294, 2008 2. Choi WS et al, J Vet Sci 6(3), 2005 3. Koh PO et al, J Vet Med Sci 69(9), 2007 4. Torry RJ et al, J Heart Lung Transplant 28(2), 2009 5. Sands M et al, Respir Res 12, 2011

NCBI and Uniprot Product Information

• NCBI GI #: 16758378
• NCBI GeneID: 94203
• NCBI Accession #: NP_446047.1
• NCBI GenBank Nucleotide #: NM_053595
• UniProt Accession #: Q63434
• Molecular Weight: 15,14 kDa
• NCBI Official Full Name: placenta growth factor
• NCBI Official Synonym Full Names: placental growth factor
• NCBI Official Symbol: Pgf
• NCBI Official Synonym Symbols: Plgf
• NCBI Protein Information: placenta growth factor
• UniProt Protein Name: Placenta growth factor
• UniProt Gene Name: Pgf
• UniProt Synonym Gene Names: Plgf; PlGF
• UniProt Entry Name: PLGF_RAT

NCBI Description

forms a heterodimer with VEGF; may play a role in vascular endothelial cell proliferation [RGD, Feb 2006]

Uniprot Description

Function: Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Also promotes cell tumor growth

By similarity.

Subunit structure: Antiparallel homodimer; disulfide-linked. Also found as heterodimer with VEGFA/VEGF. Ref.1

Subcellular location: Secreted

By similarity.

Sequence similarities: Belongs to the PDGF/VEGF growth factor family.