PlGF-2 active protein

Human PlGF-2

Cat. Num. AAA691507

• Gene Names: PGF; PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
• Reactivity: Human
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: PlGF-2; Human PlGF-2; Recombinant Human Placenta Growth Factor-2; PlGF; Placenta Growth Factor; PlGF-2 active protein

• Host: Insect Cells
• Reactivity: Human
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized; 50 mM acetic acid
• Sequence: LPAVPPQQWALSALNLSSEVVPFQEVLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKRGKRRREKQRPTDCHLCGDAVPRR
• Sequence Length: 152

• Stabilizer: BSA
• Length (aa): 152
• Reconstitution: The PIGF-2 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.
• Biological Activity: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human sFlt-1 can bind to immobilized rh-P1GF-2 (50ng/well) with a linear range at 0.5-10ng/ml
• Preparation and Storage: The lyophilized human PIGF-2, though stable at room temperature, is best stored in working aliquots at -20 degree C to -70 degree C

Testing Data

ELISA (EIA)

(Figure 2.Functional ELISA: Recombinant human PlGF-2 was coated with 0.5µg/ml and increasing amounts of recombinant human sFlt-1(5) was added as standard [MBS691669]. The monoclonal mouse anti-human VEGFR1/Flt-1 antibody [MBS690832] in combination with a goat anti-mouse Biotin antibody was used for detection.)

Related Product Information for PlGF-2 active protein

Human Placenta Growth Factor-2 (PlGF-2), a 22 kDa protein consisting of 152 amino acid residues is produced as a homodimer. PlGF is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF acts only as a weak mitogen for those cell types possessing receptors for binding (e.g. vascular endothelial cells). At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes). In addition to its action as a weak mitogen it is also a chemoattractant for monocytes and endothelial cells. Two different proteins are generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF is apparently a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms possess similar biological activities. If PlGF is angiogenic in vivo is not clear. However, heterodimers between VEGF and PlGF are mitogenic for endothelial cells and have strong angiogenic activity in vivo (e.g. in the CAM assay or in the cornea pocket assay). Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A much related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.

Product Categories/Family for PlGF-2 active protein

Cytokines & Growth Factors

References

1. DiPalma, T. et al. (1996) Mamm. Genome 7:6. 2. Cao, Y. et al. (1997) Biochem. Biophys. Res. Commun. 235:493. 3. Ferrara, N. et al. (1997) Endocrin. Rev. 18:4 4. Kim KJ et al, Exp Mol Med 44:10-9, 2012 5. De Falco S, Exp Mol Med 44:1-9, 2012

NCBI and Uniprot Product Information

• NCBI GI #: 333033785
• NCBI GeneID: 5228
• NCBI Accession #: NP_001193941.1
• NCBI GenBank Nucleotide #: NM_001207012.1
• UniProt Accession #: P49763; Q07101; Q9BV78; Q9Y6S8
• Molecular Weight: ~ 45 kDa (Dimer)
• NCBI Official Full Name: placenta growth factor isoform 2
• NCBI Official Synonym Full Names: placental growth factor
• NCBI Official Symbol: PGF
• NCBI Official Synonym Symbols: PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
• NCBI Protein Information: placenta growth factor; placental growth factor, vascular endothelial growth factor-related protein
• UniProt Protein Name: Placenta growth factor
• UniProt Gene Name: PGF
• UniProt Synonym Gene Names: PGFL; PLGF; PlGF
• UniProt Entry Name: PLGF_HUMAN

NCBI Description

This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

Function: Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. Ref.8

Subunit structure: Antiparallel homodimer; disulfide-linked. Also found as heterodimer with VEGFA/VEGF. Isoform PlGF-3 is found both as homodimer and as monomer.

Subcellular location: Secreted. Note: The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.

Tissue specificity: While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.

Domain: Isoform PlGF-2 contains a basic insert which acts as a cell retention signal.

Post-translational modification: N-glycosylated.

Sequence similarities: Belongs to the PDGF/VEGF growth factor family.