Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-5 (IL5) Recombinant Protein | IL5 recombinant protein

Recombinant Sheep Interleukin-5 (IL5)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-5 (IL5); Recombinant Sheep Interleukin-5 (IL5); IL5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-132, Full length protein
Sequence
VESTMNRLVAETLTLLSTHQTLLIGDGNLMIPTPQHTNHQLCIEEVFQGIDTLKNQTAQGDAVKKIFRNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQVFLGVINTEWTMES
Sequence Length
113
Species
Sheep
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IL5 recombinant protein
This protein is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes. The receptor of this cytokine is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2
GM-CSF). This gene, together with those for interleukin 4 (IL4), interleukin 13 (IL13), and CSF2, form a cytokine gene cluster on chromosome 5. This cytokine, IL4, and IL13 are found to be regulated coordinately by long-range regulatory elements spread over 120 kilobases on chromosome 5q31.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,974 Da
NCBI Official Full Name
interleukin-5
NCBI Official Symbol
IL5
NCBI Protein Information
interleukin-5
UniProt Protein Name
Interleukin-5
Protein Family
UniProt Gene Name
IL5
UniProt Synonym Gene Names
IL-5; TRF

Uniprot Description

Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.

Research Articles on IL5

Similar Products

Product Notes

The IL5 il5 (Catalog #AAA1425454) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-132, Full length protein. The amino acid sequence is listed below: VESTMNRLVA ETLTLLSTHQ TLLIGDGNLM IPTPQHTNHQ LCIEEVFQGI DTLKNQTAQG DAVKKIFRNL SLIKEYIDLQ KRKCGGERWR VKQFLDYLQV FLGVINTEWT MES. It is sometimes possible for the material contained within the vial of "Interleukin-5 (IL5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.