Interleukin-15 Recombinant Protein | IL15 recombinant protein
Recombinant Macaca mulatta Interleukin-15
Gene Names
IL15; IL-15
Reactivity
MACMU
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Interleukin-15; Recombinant Macaca mulatta Interleukin-15; IL15 recombinant protein
Host
Yeast
Reactivity
MACMU
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycerol
Sequence Positions
Full Length, 49-162aa
Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Immunogen Description
Expression Region:49-162aaSequence Info:Full Length
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for IL15 recombinant protein
Recombinant Protein
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2Rbeta and probably IL-2R gamma but not IL-2R alpha.
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2Rbeta and probably IL-2R gamma but not IL-2R alpha.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 14.9 kD
NCBI Official Full Name
interleukin-15
NCBI Official Symbol
IL15
NCBI Official Synonym Symbols
IL-15
NCBI Protein Information
interleukin-15
UniProt Protein Name
Interleukin-15
Protein Family
UniProt Gene Name
IL15
UniProt Synonym Gene Names
IL-15
Uniprot Description
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Research Articles on IL15
Similar Products
Product Notes
The IL15 il15 (Catalog #AAA9422344) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 49-162aa. The Recombinant Macaca mulatta Interleukin-15 reacts with MACMU and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: NWVNVISDLK KIEDLIQSMH IDATLYTESD VHPSCKVTAM KCFLLELQVI SHESGDTDIH DTVENLIILA NNILSSNGNI TESGCKECEE LEEKNIKEFL QSFVHIVQMF INTS. It is sometimes possible for the material contained within the vial of "Interleukin-15, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
