Interleukin-15 Recombinant Protein | IL15 recombinant protein

Recombinant Human Interleukin-15 protein

Cat. Num. AAA718887

• Gene Names: IL15; IL-15
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-15; Recombinant Human Interleukin-15 protein; IL15 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 49-162aa; Full Length of Mature Protein
• Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Sequence Length: 162

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for IL15 recombinant protein

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Product Categories/Family for IL15 recombinant protein

Metabolism

References

Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor.Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alderson M.R., Watson J.D., Anderson D.M., Giri J.G.Science 264:965-968(1994)

NCBI and Uniprot Product Information

• NCBI GI #: 10835153
• NCBI GeneID: 3600
• NCBI Accession #: NP_000576.1
• NCBI GenBank Nucleotide #: NM_000585.4
• UniProt Accession #: P40933; O00440; O43512; Q495Z8; Q6FGX7; Q93058; Q9UBA3; D3DNZ2
• Molecular Weight: 16.8 kDa
• NCBI Official Full Name: interleukin-15 isoform 1 preproprotein
• NCBI Official Synonym Full Names: interleukin 15
• NCBI Official Symbol: IL15
• NCBI Official Synonym Symbols: IL-15
• NCBI Protein Information: interleukin-15
• UniProt Protein Name: Interleukin-15
• Protein Family: Interleukin
• UniProt Gene Name: IL15
• UniProt Synonym Gene Names: IL-15
• UniProt Entry Name: IL15_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011]

Uniprot Description

IL15: Cytokine that stimulates the proliferation of T- lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. Belongs to the IL-15/IL-21 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Cytokine; Cell cycle regulation

Chromosomal Location of Human Ortholog: 4q31

Cellular Component: cell surface; cytoplasm; endosome; extracellular region; extracellular space; Golgi apparatus; integral to plasma membrane; membrane; nucleoplasm

Molecular Function: cytokine activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; protein binding

Biological Process: aging; cell maturation; cell-cell signaling; extrathymic T cell selection; hyaluronan metabolic process; immune response; inflammatory response; lymph node development; natural killer cell differentiation; negative regulation of smooth muscle cell proliferation; NK T cell proliferation; positive regulation of cell proliferation; positive regulation of immune response; positive regulation of inflammatory response; positive regulation of interleukin-17 production; positive regulation of natural killer cell differentiation; positive regulation of natural killer cell proliferation; positive regulation of T cell proliferation; positive regulation of tissue remodeling; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of defense response to virus by host; regulation of T cell differentiation; signal transduction; skeletal muscle atrophy; tyrosine phosphorylation of Stat5 protein