Western Blot (WB)
(WB Suggested Anti-Dcaf7 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)
Rabbit Dcaf7 Polyclonal Antibody | anti-DCAF7 antibody
Dcaf7 antibody - N-terminal region
Gene Names
Dcaf7; HAN11; Wdr68; C86529; 1700012F10Rik; 2610037L01Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dcaf7; Polyclonal Antibody; Dcaf7 antibody - N-terminal region; anti-DCAF7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG
Sequence Length
342
Applicable Applications for anti-DCAF7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Dcaf7 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)
Western Blot (WB)
(WB Suggested Anti-Dcaf7 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)
Related Product Information for anti-DCAF7 antibody
This is a rabbit polyclonal antibody against Dcaf7. It was validated on Western Blot
Target Description: Dcaf7 is involved in craniofacial development. It acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. It associates with DIAPH1 and controls GLI1 transcriptional activity. It could be involved in skin development. It may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Target Description: Dcaf7 is involved in craniofacial development. It acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. It associates with DIAPH1 and controls GLI1 transcriptional activity. It could be involved in skin development. It may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Product Categories/Family for anti-DCAF7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
DDB1- and CUL4-associated factor 7
NCBI Official Synonym Full Names
DDB1 and CUL4 associated factor 7
NCBI Official Symbol
Dcaf7
NCBI Official Synonym Symbols
HAN11; Wdr68; C86529; 1700012F10Rik; 2610037L01Rik
NCBI Protein Information
DDB1- and CUL4-associated factor 7
UniProt Protein Name
DDB1- and CUL4-associated factor 7
Protein Family
UniProt Gene Name
Dcaf7
UniProt Synonym Gene Names
Han11; Wdr68
Uniprot Description
Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex ().
Research Articles on DCAF7
Similar Products
Product Notes
The DCAF7 dcaf7 (Catalog #AAA3210613) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dcaf7 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Dcaf7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCAF7 dcaf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLHGKRKEIY KYEAPWTVYA MNWSVRPDKR FRLALGSFVE EYNNKVQLVG. It is sometimes possible for the material contained within the vial of "Dcaf7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
