SDS-PAGE
Transgelin Recombinant Protein | TAGLN recombinant protein
Recombinant Human Transgelin
Gene Names
TAGLN; SM22; SMCC; TAGLN1; WS3-10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transgelin; Recombinant Human Transgelin; 22 kDa actin-binding protein; Protein WS3-10; Smooth muscle protein 22-alpha; SM22-alpha; TAGLN recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-201. Full Length of Mature Protein
Sequence
ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for TAGLN recombinant protein
Actin cross-linking/gelling protein. Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Product Categories/Family for TAGLN recombinant protein
References
A novel gene encoding a smooth muscle protein is overexpressed in senescent human fibroblasts.Thweatt R., Lumpkin C.K. Jr., Goldstein S.Biochem. Biophys. Res. Commun. 187:1-7(1992)
Gene cloning and nucleotide sequence of SM22 alpha from the chicken gizzard smooth muscle.Nishida W., Kitami Y., Abe M., Kiwada K.Biochem. Int. 23:663-668(1991)
Expression and cytogenetic localization of the human SM22 gene (TAGLN)
.Camoretti-Mercado B., Forsythe S.M., Lebeau M.M., Espinosa R.D. III, Vieira J.E., Halayko A.J., Willadsen S., Kurtz B., Ober C., Evans G.A., Thweatt R., Shapiro S., Niu Q., Qin Y., Padrid P.A., Solway J.Genomics 49:452-457(1998)
Structure and expression of the human SM22alpha gene, assignment of the gene to chromosome 11, and repression of the promoter activity by cytosine DNA methylation.Yamamura H., Masuda H., Ikeda W., Tokuyama T., Takagi M., Shibata N., Tatsuta M., Takahashi K.J. Biochem. 122:157-167(1997)
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011)
N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49.5 kDa
NCBI Official Full Name
transgelin
NCBI Official Synonym Full Names
transgelin
NCBI Official Symbol
TAGLN
NCBI Official Synonym Symbols
SM22; SMCC; TAGLN1; WS3-10
NCBI Protein Information
transgelin
UniProt Protein Name
Transgelin
Protein Family
UniProt Gene Name
TAGLN
UniProt Synonym Gene Names
SM22; WS3-10; SM22-alpha
UniProt Entry Name
TAGL_HUMAN
NCBI Description
The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
TAGLN: Actin cross-linking/gelling protein. Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence. Belongs to the calponin family.
Protein type: Actin-binding; Nuclear receptor co-regulator; Motility/polarity/chemotaxis
Chromosomal Location of Human Ortholog: 11q23.2
Cellular Component: cytoplasm
Molecular Function: actin binding; protein binding
Biological Process: epithelial cell differentiation; muscle development
Research Articles on TAGLN
Similar Products
Product Notes
The TAGLN tagln (Catalog #AAA717278) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-201. Full Length of Mature Protein. The amino acid sequence is listed below: ANKGPSYGMS REVQSKIEKK YDEELEERLV EWIIVQCGPD VGRPDRGRLG FQVWLKNGVI LSKLVNSLYP DGSKPVKVPE NPPSMVFKQM EQVAQFLKAA EDYGVIKTDM FQTVDLFEGK DMAAVQRTLM ALGSLAVTKN DGHYRGDPNW FMKKAQEHKR EFTESQLQEG KHVIGLQMGS NRGASQAGMT GYGRPRQIIS . It is sometimes possible for the material contained within the vial of "Transgelin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
