Insulin-like growth factor I Recombinant Protein | IGF-1 recombinant protein

Recombinant Rat Insulin-like growth factor I

Cat. Num. AAA717243

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Insulin-like growth factor I; Recombinant Rat Insulin-like growth factor I; Somatomedin; IGF-1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 49-118aa; Full Length
• Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
• Sequence Length: 143

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for IGF-1 recombinant protein

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation.

Product Categories/Family for IGF-1 recombinant protein

Signal Transduction

References

Mosaic evolution of the insulin-like growth factors. Organization, sequence, and expression of the rat insulin-like growth factor I gene.Shimatsu A., Rotwein P.J. Biol. Chem. 262:7894-7900(1987) Isolation of rat testis cDNAs encoding an insulin-like growth factor I precursor.Casella S.J., Smith E.P., van Wyk J.J., Joseph D.R., Hynes M.A., Hoyt E.C., Lund P.K.DNA 6:325-330(1987) Molecular cloning of rat insulin-like growth factor I complementary deoxyribonucleic acids differential messenger ribonucleic acid processing and regulation by growth hormone in extrahepatic tissues.Roberts C.T. Jr., Lasky S.R., Lowe W.L. Jr., Seaman W.T., LeRoith D.Mol. Endocrinol. 1:243-248(1987) Sequence of two rat insulin-like growth factor I mRNAs differing within the 5' untranslated region.Shimatsu A., Rotwein P.Nucleic Acids Res. 15:7196-7196(1987) A new cDNA clone relating to larger molecular species of rat insulin-like growth factor-I mRNA.Kato H., Okoshi A., Miura Y., Noguchi T.Agric. Biol. Chem. 54:1599-1601(1990) Identification, characterization, and regulation of a rat complementary deoxyribonucleic acid which encodes insulin-like growth factor-I.Murphy L.J., Bell G.I., Duckworth M.L., Friesen H.G.Endocrinology 121:684-691(1987) Primary structure of rat insulin-like growth factor-I and its biological activities.Tamura K., Kobayashi M., Ishii Y., Tamura T., Hashimoto K., Nakamura S., Niwa M., Zapf J.J. Biol. Chem. 264:5616-5621(1989)

NCBI and Uniprot Product Information

• NCBI GI #: 163659885
• NCBI GeneID: 24482
• NCBI Accession #: NP_001075946.2
• NCBI GenBank Nucleotide #: NM_001082477.2
• UniProt Accession #: P08025; P08024
• Molecular Weight: 34.7 kDa
• NCBI Official Full Name: insulin-like growth factor I isoform a preproprotein
• NCBI Official Synonym Full Names: insulin-like growth factor 1
• NCBI Official Symbol: Igf1
• NCBI Protein Information: insulin-like growth factor I
• UniProt Protein Name: Insulin-like growth factor I
• Protein Family: Insulin-like growth factor
• UniProt Gene Name: Igf1
• UniProt Synonym Gene Names: Igf-1; IGF-I
• UniProt Entry Name: IGF1_RAT

NCBI Description

growth factor; plays a major role in mammalian growth [RGD, Feb 2006]

Uniprot Description

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca2+-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 ().