DNA-binding protein inhibitor ID-2 (Id2) Recombinant Protein | Id2 recombinant protein

Recombinant Rat DNA-binding protein inhibitor ID-2 (Id2)

Cat. Num. AAA951961

• Gene Names: Id2; Ac2-300
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-binding protein inhibitor ID-2 (Id2); Recombinant Rat DNA-binding protein inhibitor ID-2 (Id2); Id2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-134, Full length protein
• Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQTSRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG
• Sequence Length: 134

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Id2 recombinant protein

This protein belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 6981072
• NCBI GeneID: 25587
• NCBI Accession #: NP_037192.1
• NCBI GenBank Nucleotide #: NM_013060.3
• UniProt Accession #: P41137
• Molecular Weight: 14,989 Da
• NCBI Official Full Name: DNA-binding protein inhibitor ID-2
• NCBI Official Synonym Full Names: inhibitor of DNA binding 2
• NCBI Official Symbol: Id2
• NCBI Official Synonym Symbols: Ac2-300
• NCBI Protein Information: DNA-binding protein inhibitor ID-2
• UniProt Protein Name: DNA-binding protein inhibitor ID-2
• Protein Family: DNA-binding protein inhibitor
• UniProt Gene Name: Id2
• UniProt Synonym Gene Names: Id-2

NCBI Description

a helix-loop-helix protein that lacks a DNA binding domain; involved in transcription regulation [RGD, Feb 2006]

Uniprot Description

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism ().