Auxin-responsive protein IAA30 (IAA30) Recombinant Protein | IAA30 recombinant protein

Recombinant Arabidopsis thaliana Auxin-responsive protein IAA30 (IAA30)

Cat. Num. AAA1396326

• Gene Names: IAA30; indole-3-acetic acid inducible 30
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Auxin-responsive protein IAA30 (IAA30); Recombinant Arabidopsis thaliana Auxin-responsive protein IAA30 (IAA30); IAA30 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-172, Full length protein
• Sequence: MGRGRSSSSSSIESSCKSNPFGVSSSNTRNLSTDLRLGLSFGSSSGQYYNGGDNHEYDGVGAAEEMMIMEEEEQNECNSVGSFYVKVNMEGVPIGRKIDLLSLNGYHDLITTLDYMFNASILWAEEEDMCSEKSHVLTYADKEGDWMMVGDVPWEMFLSSVRRLKISRAYHY
• Sequence Length: 172

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15228681
• NCBI GeneID: 825383
• NCBI Accession #: NP_191769.1
• NCBI GenBank Nucleotide #: NM_116075.3
• UniProt Accession #: Q9M1R4; Q2VW99
• Molecular Weight: 19,238 Da
• NCBI Official Full Name: indole-3-acetic acid inducible 30
• NCBI Official Symbol: IAA30
• NCBI Official Synonym Symbols: indole-3-acetic acid inducible 30
• NCBI Protein Information: indole-3-acetic acid inducible 30
• UniProt Protein Name: Auxin-responsive protein IAA30
• Protein Family: Auxin-responsive protein
• UniProt Gene Name: IAA30

NCBI Description

Encodes a member of the Aux/IAA family of proteins implicated in auxin signaling. IAA30 lacks the conserved degron (domain II) found in many family members. IAA30 transcripts are induced by auxin treatment and accumulate preferentially in the quiescent center cells of the root meristem. Overexpression of IAA30 leads to defects in gravitropism, root development, root meristem maintenance, and cotyledon vascular development. Target of LEC2 and AGL15. Promotes somatyic embryogenesis.

Uniprot Description

Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.