Checkpoint protein HUS1 (Hus1) Recombinant Protein | Hus1 recombinant protein

Recombinant Mouse Checkpoint protein HUS1 (Hus1)

Cat. Num. AAA1465427

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Checkpoint protein HUS1 (Hus1); Recombinant Mouse Checkpoint protein HUS1 (Hus1); Hus1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-280, full length protein
• Sequence: MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCLTVSVELVSSSSSSRIVVHDIPIKVLPRRLWKDLQEPSIPDCDVSICLPALKMMKSVVEKMRNISNQLVIEANLKGELNLKIETELVCVTTHFKDLENPLLPSDSVSQNRHPEDMAKVHIDIKKLLQFLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPALS
• Sequence Length: 280

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Hus1 recombinant protein

This protein is a component of an evolutionarily conserved, genotoxin-activated checkpoint complex that is involved in the cell cycle arrest in response to DNA damage. This protein forms a heterotrimeric complex with checkpoint proteins RAD9 and RAD1. In response to DNA damage, the trimeric complex interacts with another protein complex consisting of checkpoint protein RAD17 and four small subunits of the replication factor C (RFC), which loads the combined complex onto the chromatin. The DNA damage induced chromatin binding has been shown to depend on the activation of the checkpoint kinase ATM, and is thought to be an early checkpoint signaling event.

NCBI and Uniprot Product Information

• NCBI GI #: 746816115
• NCBI GeneID: 15574
• NCBI Accession #: NP_001290461.1
• NCBI GenBank Nucleotide #: NM_001303532.1
• UniProt Accession #: Q8BQY8; O70543; Q6P8H5
• Molecular Weight: 33,848 Da
• NCBI Official Full Name: checkpoint protein HUS1 isoform 2
• NCBI Official Synonym Full Names: HUS1 checkpoint clamp component
• NCBI Official Symbol: Hus1
• NCBI Protein Information: checkpoint protein HUS1
• UniProt Protein Name: Checkpoint protein HUS1
• Protein Family: Checkpoint protein
• UniProt Gene Name: Hus1
• UniProt Synonym Gene Names: mHUS1

NCBI Description

This gene encodes a component of a cell cycle checkpoint complex that causes cell cycle arrest in response to bulky DNA lesions and DNA replication blockage. Together with the proteins Rad9 and Rad1, the encoded protein forms a heterotrimeric complex known as the 9-1-1 complex. Mice lacking the encoded protein develop spontaneous chromosomal abnormalities resulting in embryonic lethality. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Uniprot Description

Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase ().