Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Styk1 blocking peptide

Styk1 Peptide - middle region

Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Styk1; Styk1 Peptide - middle region; Styk1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YHIGKQILLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHA
Sequence Length
340
Applicable Applications for Styk1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Styk1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Styk1 Antibody, made

Target Description: The function of this protein remains unknown.
Product Categories/Family for Styk1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
37kDa
UniProt Protein Name
Tyrosine-protein kinase STYK1
Protein Family
UniProt Gene Name
Styk1
UniProt Synonym Gene Names
Nok; mNOK
UniProt Entry Name
STYK1_MOUSE

Uniprot Description

STYK1: Probable tyrosine protein-kinase, which has strong transforming capabilities on a variety of cell lines. When overexpressed, it can also induce tumor cell invasion as well as metastasis in distant organs. May act by activating both MAP kinase and phosphatidylinositol 3'-kinases (PI3K) pathways. Belongs to the protein kinase superfamily. Tyr protein kinase family.

Protein type: Protein kinase, TK; Kinase, protein; Protein kinase, tyrosine (receptor); EC 2.7.10.2; Membrane protein, integral; Oncoprotein; TK group; TK-Unique family

Cellular Component: extrinsic to internal side of plasma membrane; membrane; plasma membrane; integral to membrane

Molecular Function: transferase activity; protein-tyrosine kinase activity; transferase activity, transferring phosphorus-containing groups; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; kinase activity; ATP binding; protein kinase activity

Biological Process: innate immune response; cell differentiation; phosphorylation; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation

Similar Products

Product Notes

The Styk1 styk1 (Catalog #AAA3233546) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Styk1 Peptide - middle region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Styk1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Styk1 styk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YHIGKQILLA LEFLQEKHLF HGDVAARNIL IQSDLTPKLC HLGLAYEVHA. It is sometimes possible for the material contained within the vial of "Styk1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.