CD96 active protein

Recombinant Human CD96 Protein

Cat. Num. AAA9140355

• Gene Names: CD96; TACTILE
• Purity: >95% by SDS-PAGE.
• Synonyms: CD96; Recombinant Human CD96 Protein; T-cell surface protein tactile; Cell surface antigen CD96; T cell-activated increased late expression protein; CD96 active protein

• Host: Human Cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
• Sequence: VWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAVYHPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSSKISSEFTYAWSVEDNGTQETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQIFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNSTDVLVERRFTCLL
• Sequence Length: 585

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. When Recombinant Human CD155/PVR is immobilized at 1 ug/mL (100 uL/well) the concentration of Recombinant Human CD96 that produces 50% of the optimal binding response is 0.3-1.8 ug/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD96 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Related Product Information for CD96 active protein

Recombinant Human CD96 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val22-Met503) of human CD96 (Accession #P40200-2) fused with a 6xHis tag at the C-terminus.

Product Categories/Family for CD96 active protein

Immune Checkpoint

NCBI and Uniprot Product Information

• NCBI GI #: 161784352
• NCBI GeneID: 10225
• UniProt Accession #: P40200
• NCBI Official Full Name: T-cell surface protein tactile
• NCBI Official Synonym Full Names: CD96 molecule
• NCBI Official Symbol: CD96
• NCBI Official Synonym Symbols: TACTILE
• NCBI Protein Information: T-cell surface protein tactile
• UniProt Protein Name: T-cell surface protein tactile
• Protein Family: T-cell surface protein tactile
• UniProt Gene Name: CD96

NCBI Description

The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also function in antigen presentation. Alternative splicing generates multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2016]

Uniprot Description

May be involved in adhesive interactions of activated T and NK cells during the late phase of the immune response. Promotes NK cell-target adhesion by interacting with PVR present on target cells. May function at a time after T and NK cells have penetrated the endothelium using integrins and selectins, when they are actively engaging diseased cells and moving within areas of inflammation.