Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CD155/PVR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 95-105 kDa.)

CD155/PVR active protein

Recombinant Human CD155/PVR Protein

Gene Names
PVR; PVS; HVED; CD155; NECL5; TAGE4; Necl-5
Purity
>97% by SDS-PAGE.
Synonyms
CD155/PVR; Recombinant Human CD155/PVR Protein; CD155; HVED; Necl-5; NECL5; PVS; TAGE4; CD155/PVR active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN
Sequence Length
417
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized human DNAM1 at 2 ug/ml (100 ul/well) can bind human CD155-Fc with a linear ranger of 0.032-0.8 ug/ml.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD155/PVR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 95-105 kDa.)

SDS-Page (Recombinant Human CD155/PVR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 95-105 kDa.)
Related Product Information for CD155/PVR active protein
Description: Recombinant Human CD155/PVR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp28-Asn343) of human CD155/PVR (Accession #NP_006496.4) fused with an Fc, 6xHis tag at the C-terminus.

Background: This protein is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication.
Product Categories/Family for CD155/PVR active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
poliovirus receptor isoform alpha
NCBI Official Synonym Full Names
PVR cell adhesion molecule
NCBI Official Symbol
PVR
NCBI Official Synonym Symbols
PVS; HVED; CD155; NECL5; TAGE4; Necl-5
NCBI Protein Information
poliovirus receptor
UniProt Protein Name
Poliovirus receptor
UniProt Gene Name
PVR
UniProt Synonym Gene Names
PVS; NECL-5
UniProt Entry Name
PVR_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

PVR: Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration. Serves as a receptor for poliovirus attachment to target cells. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport. Belongs to the nectin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Immunoglobulin superfamily; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: extracellular space; cell surface; focal adhesion; cytoplasm; plasma membrane; integral to membrane

Molecular Function: viral receptor activity; protein binding; receptor activity; cell adhesion molecule binding

Biological Process: intercellular junction assembly and maintenance; regulation of immune response; cell migration; entry of virus into host cell; cell-cell adhesion; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; response to virus; susceptibility to natural killer cell mediated cytotoxicity; positive regulation of natural killer cell mediated cytotoxicity

Research Articles on CD155/PVR

Similar Products

Product Notes

The CD155/PVR pvr (Catalog #AAA9141713) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DVVVQAPTQV PGFLGDSVTL PCYLQVPNME VTHVSQLTWA RHGESGSMAV FHQTQGPSYS ESKRLEFVAA RLGAELRNAS LRMFGLRVED EGNYTCLFVT FPQGSRSVDI WLRVLAKPQN TAEVQKVQLT GEPVPMARCV STGGRPPAQI TWHSDLGGMP NTSQVPGFLS GTVTVTSLWI LVPSSQVDGK NVTCKVEHES FEKPQLLTVN LTVYYPPEVS ISGYDNNWYL GQNEATLTCD ARSNPEPTGY NWSTTMGPLP PFAVAQGAQL LIRPVDKPIN TTLICNVTNA LGARQAELTV QVKEGPPSEH SGMSRN. It is sometimes possible for the material contained within the vial of "CD155/PVR, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.