Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TTLL3 blocking peptide

TTLL3 Peptide - C-terminal region

Gene Names
TTLL3; HOTTL
Reactivity
Human
Synonyms
TTLL3; TTLL3 Peptide - C-terminal region; TTLL3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
APVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDM
Sequence Length
434
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TTLL3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TTLL3 Antibody, made

Target Description: TTLL3 is a monoglycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. It is involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. It is not involved in elongation step of the polyglycylation reaction.
Product Categories/Family for TTLL3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48kDa
NCBI Official Full Name
TTLL3, partial
NCBI Official Synonym Full Names
tubulin tyrosine ligase like 3
NCBI Official Symbol
TTLL3
NCBI Official Synonym Symbols
HOTTL
NCBI Protein Information
tubulin monoglycylase TTLL3
Protein Family

Research Articles on TTLL3

Similar Products

Product Notes

The TTLL3 (Catalog #AAA3240709) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TTLL3 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: APVGRSRPKA NSRPDCDKPR AEACPMKRLS PLKPLPLVGT FQRRRGLGDM. It is sometimes possible for the material contained within the vial of "TTLL3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.