Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TNIP1 blocking peptide

TNIP1 Peptide - N-terminal region

Gene Names
TNIP1; VAN; NAF1; ABIN-1; nip40-1
Reactivity
Human
Applications
Western Blot
Synonyms
TNIP1; TNIP1 Peptide - N-terminal region; TNIP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSSHANAMALG
Sequence Length
636
Applicable Applications for TNIP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TNIP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TNIP1 Antibody, made

Target Description: TNIP1 interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal. TNIP1 increases cell surface CD4(T4) antigen expression. TNIP1 interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. TNIP1 may regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production.
Product Categories/Family for TNIP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
TNFAIP3-interacting protein 1 isoform 3
NCBI Official Synonym Full Names
TNFAIP3 interacting protein 1
NCBI Official Symbol
TNIP1
NCBI Official Synonym Symbols
VAN; NAF1; ABIN-1; nip40-1
NCBI Protein Information
TNFAIP3-interacting protein 1
UniProt Protein Name
TNFAIP3-interacting protein 1
UniProt Gene Name
TNIP1
UniProt Synonym Gene Names
KIAA0113; NAF1; ABIN-1; Naf1; VAN; hVAN
UniProt Entry Name
TNIP1_HUMAN

NCBI Description

This gene encodes an A20-binding protein which plays a role in autoimmunity and tissue homeostasis through the regulation of nuclear factor kappa-B activation. Mutations in this gene have been associated with psoriatic arthritis, rheumatoid arthritis, and systemic lupus erythematosus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

TNIP1: Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal; however, binding to A20/TNFAIP3 seems not to be required for this function. Inhibits NF-kappa-B activation by regulating A20/TNFAIP3-mediated deubiquitination of IKBKG; proposed to link A20/TNFAIP3 to ubiquitinated IKBKG. Involved in regulation of EGF-induced ERK1/ERK2 signaling pathway; blocks MAPK3/MAPK1 nuclear translocation and MAPK1-dependent transcricption. Increases cell surface CD4(T4) antigen expression. Involved in the anti-inflammatory response of macrophages and positively regulates TLR-induced activation of CEBPB. Involved in the prevention of autoimmunity; this function implicates binding to polyubiquitin. Involved in leukocyte integrin activation during inflamation; this function is mediated by association with SELPLG and dependent on phosohorylation by SRC-family kinases. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production. In case of infection, promotes association of IKBKG with Shigella flexneri E3 ubiquitin-protein ligase ipah9.8 p which in turn promotes polyubiquitination of IKBKG leading to its proteasome-dependent degradation and thus is perturbing NF-kappa-B activation during bacterial infection. Interacts with TNFAIP3 and IKBKG; facilitates TNFAIP3- mediated de-ubiquitination of NEMO/IKBKG. Interacts with HIV-1 matrix protein. Interacts with Shigella flexneri ipah9.8; the interaction promotes polyubiquitination of IKBKG. Interacts with polyubiquitin. Interacts with MAPK1, SELPLG and PIK3CD. Interacts with IKBKG (polyubiquitinated). Interacts with IRAK1 (polyubiquitinated). Interacts with MYD88; the interaction is indicative for participation in an activated TLR-signaling complex. Ubiquitous. Strongly expressed in peripheral blood lymphocytes, spleen and skeletal muscle, and is weakly expressed in the brain. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 5q32-q33.1

Cellular Component: cytoplasm; intracellular; nucleus

Molecular Function: protein binding; ubiquitin-specific protease activity; mitogen-activated protein kinase binding

Biological Process: MyD88-dependent toll-like receptor signaling pathway; leukocyte adhesion; negative regulation of viral genome replication; glycoprotein biosynthetic process; translation; defense response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of I-kappaB kinase/NF-kappaB cascade; inflammatory response; positive regulation of inflammatory response

Research Articles on TNIP1

Similar Products

Product Notes

The TNIP1 tnip1 (Catalog #AAA3240218) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TNIP1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNIP1 tnip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SPTAPACPSD KPAPVQKPPS SGTSSEFEVV TPEEQNSPES SSHANAMALG. It is sometimes possible for the material contained within the vial of "TNIP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.