Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TNFAIP8L2 blocking peptide

TNFAIP8L2 Peptide - N-terminal region

Gene Names
TNFAIP8L2; TIPE2
Reactivity
Human
Applications
Western Blot
Synonyms
TNFAIP8L2; TNFAIP8L2 Peptide - N-terminal region; TNFAIP8L2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
Sequence Length
148
Applicable Applications for TNFAIP8L2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TNFAIP8L2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TNFAIP8L2 Antibody, made

Target Description: TNFAIP8L2 acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. It is a negative regulator of Toll-like receptor and T-cell receptor function. It prevents hyperresponsiveness of the immune system and maintains immune homeostasis and inhibits JUN/AP1 and NF-kappa-B activation. TNFAIP8L2 promotes Fas-induced apoptosis.
Product Categories/Family for TNFAIP8L2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
tumor necrosis factor alpha-induced protein 8-like protein 2
NCBI Official Synonym Full Names
TNF alpha induced protein 8 like 2
NCBI Official Symbol
TNFAIP8L2
NCBI Official Synonym Symbols
TIPE2
NCBI Protein Information
tumor necrosis factor alpha-induced protein 8-like protein 2
UniProt Protein Name
Tumor necrosis factor alpha-induced protein 8-like protein 2
UniProt Gene Name
TNFAIP8L2
UniProt Synonym Gene Names
TIPE2; TNF alpha-induced protein 8-like protein 2
UniProt Entry Name
TP8L2_HUMAN

Uniprot Description

TNFAIP8L2: Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis. Belongs to the TNFAIP8 family. TNFAIP8L2 subfamily.

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: cytoplasm

Molecular Function: protein binding

Biological Process: negative regulation of inflammatory response; innate immune response; negative regulation of T cell activation

Research Articles on TNFAIP8L2

Similar Products

Product Notes

The TNFAIP8L2 tnfaip8l2 (Catalog #AAA3242109) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TNFAIP8L2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFAIP8L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFAIP8L2 tnfaip8l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQAEKKLLSK MAGRSVAHLF IDETSSEVLD ELYRVSKEYT HSRPQAQRVI. It is sometimes possible for the material contained within the vial of "TNFAIP8L2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.