Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RHO blocking peptide

RHO Peptide - C-terminal region

Gene Names
RHO; RP4; OPN2; CSNBAD1
Reactivity
Human
Applications
Western Blot
Synonyms
RHO; RHO Peptide - C-terminal region; RHO blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG
Sequence Length
376
Applicable Applications for RHO blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RHO blocking peptide
This is a synthetic peptide designed for use in combination with anti-RHO Antibody, made

Target Description: PHYHIPL may play a role in the development of the central system.
Product Categories/Family for RHO blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
rhodopsin
NCBI Official Synonym Full Names
rhodopsin
NCBI Official Symbol
RHO
NCBI Official Synonym Symbols
RP4; OPN2; CSNBAD1
NCBI Protein Information
rhodopsin
UniProt Protein Name
Rhodopsin
Protein Family
UniProt Gene Name
RHO
UniProt Synonym Gene Names
OPN2
UniProt Entry Name
OPSD_HUMAN

NCBI Description

The protein encoded by this gene is found in rod cells in the back of the eye and is essential for vision in low-light conditions. The encoded protein binds to 11-cis retinal and is activated when light hits the retinal molecule. Defects in this gene are a cause of congenital stationary night blindness. [provided by RefSeq, Aug 2017]

Uniprot Description

Rhodopsin: a G-protein coupled receptor. The light-absorbing visual pigment in Rod photoreceptor cells. Mediates vision in dim light. Consists of the apoprotein, opsin, covalently linked to cis-retinal. Defects in RHO are a cause of autosomal retinitis pigmentosa and congenital stationary night blindness.

Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q21-q24

Cellular Component: Golgi membrane; Golgi apparatus; photoreceptor outer segment; photoreceptor inner segment; integral to plasma membrane; plasma membrane; rough endoplasmic reticulum membrane; intercellular junction

Molecular Function: G-protein coupled receptor activity; protein binding; spectrin binding; metal ion binding; photoreceptor activity; retinal binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; G-protein coupled receptor protein signaling pathway; red, far-red light phototransduction; regulation of rhodopsin mediated signaling; visual perception; retina development in camera-type eye; organelle organization and biogenesis; retinoid metabolic process; protein amino acid phosphorylation; protein-chromophore linkage

Disease: Fundus Albipunctatus; Night Blindness, Congenital Stationary, Autosomal Dominant 1; Retinitis Pigmentosa 4

Research Articles on RHO

Similar Products

Product Notes

The RHO rho (Catalog #AAA3239500) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RHO Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHO rho for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QDVILEVIYT DPVDLSVGTV AEITGHQLMS LSTANAKKDP SCKTCNISVG. It is sometimes possible for the material contained within the vial of "RHO, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.