RALBP1 blocking peptide

RALBP1 Peptide - N-terminal region

Cat. Num. AAA3247024

• Gene Names: RALBP1; RIP1; RLIP1; RLIP76
• Reactivity: Human
• Synonyms: RALBP1; RALBP1 Peptide - N-terminal region; RALBP1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKK
• Sequence Length: 655

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for RALBP1 blocking peptide

This is a synthetic peptide designed for use in combination with anti- RALBP1 Antibody, made

Target Description: RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RA. Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive to the active state through the action of RALGDS, which in turn is activated by RAS.

Product Categories/Family for RALBP1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 5803145
• NCBI GeneID: 10928
• NCBI Accession #: NP_006779.1
• NCBI GenBank Nucleotide #: NM_006788.3
• UniProt Accession #: Q15311
• Molecular Weight: 72 kDa
• NCBI Official Full Name: ralA-binding protein 1
• NCBI Official Synonym Full Names: ralA binding protein 1
• NCBI Official Symbol: RALBP1
• NCBI Official Synonym Symbols: RIP1; RLIP1; RLIP76
• NCBI Protein Information: ralA-binding protein 1
• UniProt Protein Name: RalA-binding protein 1
• Protein Family: RalA-binding protein
• UniProt Gene Name: RALBP1
• UniProt Synonym Gene Names: RLIP1; RLIP76; RalBP1; DNP-SG ATPase
• UniProt Entry Name: RBP1_HUMAN

NCBI Description

RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RAL (see RALA; MIM 179550). Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive to the active state through the action of RALGDS (MIM 601619), which in turn is activated by RAS (see HRAS; MIM 190020) (summary by Feig, 2003 [PubMed 12888294]).[supplied by OMIM, Nov 2010]

Uniprot Description

RALBP1: Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4-dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes. Can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin. Interacts with the GTP-bound form of RALA, RALB, CDC42 and RAC1. Interacts with REPS1 and REPS2 and this does not affect the Ral-binding activity. Interacts with DAB2IP. Interacts with catalytically active CCNB1 and CDK1 during mitosis. Interacts with EPN1, NUMB and TFAP2A during interphase and mitosis. Expressed ubiquitously but at low levels. Shows a strong expression in the erythrocytes.

Protein type: GAPs; GAPs, Rac/Rho

Chromosomal Location of Human Ortholog: 18p11.3

Cellular Component: membrane; cytosol

Molecular Function: protein binding; ATPase activity, coupled to movement of substances; ATPase activity; Rac GTPase binding; Ral GTPase binding; GTPase activator activity

Biological Process: regulation of GTPase activity; regulation of small GTPase mediated signal transduction; metabolic process; transport; small GTPase mediated signal transduction; chemotaxis; signal transduction