Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SLC35D3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Rabbit anti-Human SLC35D3 Polyclonal Antibody | anti-SLC35D3 antibody
SLC35D3 Rabbit pAb
Gene Names
SLC35D3; FRCL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
SLC35D3; Polyclonal Antibody; SLC35D3 Rabbit pAb; FRCL1; anti-SLC35D3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYL
Applicable Applications for anti-SLC35D3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 310-390 of human SLC35D3 (NP_001008783.1).
Positive Samples
HeLa, K-562
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SLC35D3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SLC35D3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,183 Da
NCBI Official Full Name
solute carrier family 35 member D3
NCBI Official Synonym Full Names
solute carrier family 35, member D3
NCBI Official Symbol
SLC35D3
NCBI Official Synonym Symbols
FRCL1
NCBI Protein Information
solute carrier family 35 member D3; frc, fringe-like 1; fringe connection-like protein 1
UniProt Protein Name
Solute carrier family 35 member D3
Protein Family
UniProt Gene Name
SLC35D3
UniProt Synonym Gene Names
FRCL1
UniProt Entry Name
S35D3_HUMAN
Uniprot Description
SLC35D3: May play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules. Belongs to the TPT transporter family. SLC35D subfamily.
Protein type: Transporter; Membrane protein, multi-pass; Membrane protein, integral; Transporter, SLC family
Chromosomal Location of Human Ortholog: 6q23.3
Cellular Component: integral to membrane
Biological Process: carbohydrate transport
Research Articles on SLC35D3
Similar Products
Product Notes
The SLC35D3 slc35d3 (Catalog #AAA9143086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC35D3 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC35D3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SLC35D3 slc35d3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NYEDLEAQPR GEEAQLSGDQ LPFVMEELPG EGGNGRSEGG EAAGGPAQES RQEVRGSPRG VPLVAGSSEE GSRRSLKDAY L. It is sometimes possible for the material contained within the vial of "SLC35D3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
