Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PTK7 blocking peptide

PTK7 Peptide - N-terminal region

Gene Names
PTK7; CCK4; CCK-4
Reactivity
Human
Applications
Western Blot
Synonyms
PTK7; PTK7 Peptide - N-terminal region; PTK7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCC
Sequence Length
1070
Applicable Applications for PTK7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PTK7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PTK7 Antibody, made

Target Description: This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling pathway and plays a role in multiple cellular processes including polarity and adhesion. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for PTK7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89 kDa
NCBI Official Full Name
inactive tyrosine-protein kinase 7 isoform e
NCBI Official Synonym Full Names
protein tyrosine kinase 7 (inactive)
NCBI Official Symbol
PTK7
NCBI Official Synonym Symbols
CCK4; CCK-4
NCBI Protein Information
inactive tyrosine-protein kinase 7
UniProt Protein Name
Inactive tyrosine-protein kinase 7
UniProt Gene Name
PTK7
UniProt Synonym Gene Names
CCK4; CCK-4
UniProt Entry Name
PTK7_HUMAN

NCBI Description

This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling pathway and plays a role in multiple cellular processes including polarity and adhesion. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

CCK4: Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis. Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Protein kinase, TK; Kinase, protein; Protein kinase, tyrosine (receptor); EC 2.7.10.1; TK group; CCK4 family

Chromosomal Location of Human Ortholog: 6p21.1-p12.2

Cellular Component: focal adhesion; integral to plasma membrane; intercellular junction

Molecular Function: protein binding; protein-tyrosine kinase activity; ATP binding

Biological Process: cell migration; peptidyl-tyrosine phosphorylation; wound healing; convergent extension; actin cytoskeleton reorganization; neural tube closure; establishment of epithelial cell polarity; establishment of planar polarity; Wnt receptor signaling pathway through beta-catenin; cell adhesion; signal transduction

Research Articles on PTK7

Similar Products

Product Notes

The PTK7 ptk7 (Catalog #AAA3245801) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PTK7 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTK7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTK7 ptk7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDGHPRPTYQ WFRDGTPLSD GQSNHTVSSK ERNLTLRPAG PEHSGLYSCC. It is sometimes possible for the material contained within the vial of "PTK7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.