Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PNKP blocking peptide

PNKP Peptide - middle region

Gene Names
PNKP; PNK; AOA4; MCSZ; EIEE10
Reactivity
Human
Applications
Western Blot
Synonyms
PNKP; PNKP Peptide - middle region; PNKP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT
Sequence Length
521
Applicable Applications for PNKP blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PNKP blocking peptide
This is a synthetic peptide designed for use in combination with anti-PNKP Antibody, made

Target Description: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.
Product Categories/Family for PNKP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
bifunctional polynucleotide phosphatase/kinase
NCBI Official Synonym Full Names
polynucleotide kinase 3'-phosphatase
NCBI Official Symbol
PNKP
NCBI Official Synonym Symbols
PNK; AOA4; MCSZ; EIEE10
NCBI Protein Information
bifunctional polynucleotide phosphatase/kinase
UniProt Protein Name
Bifunctional polynucleotide phosphatase/kinase
UniProt Gene Name
PNKP
UniProt Entry Name
PNKP_HUMAN

NCBI Description

This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.[provided by RefSeq, Sep 2010]

Uniprot Description

Pnk1: polynucleotide kinase 3'-phosphatase. May be involved in double-strand break repair by non-homologous end joining. Required for normal response to DNA damage by gamma-radiation or camptothecin in S. pombe.

Protein type: Kinase, other; EC 3.1.3.32; EC 2.7.1.78; DNA-binding; Phosphatase (non-protein)

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: nucleoplasm; membrane; nucleolus; nucleus

Molecular Function: protein binding; ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activity; polynucleotide 3'-phosphatase activity; purine nucleotide binding; endonuclease activity; double-stranded DNA binding; damaged DNA binding; nucleotide kinase activity; ATP binding

Biological Process: response to radiation; dephosphorylation; DNA damage response, detection of DNA damage; nucleotide-excision repair, DNA damage removal; response to oxidative stress; DNA repair; DNA-dependent DNA replication; nucleotide phosphorylation

Disease: Microcephaly, Seizures, And Developmental Delay; Ataxia-oculomotor Apraxia 4

Research Articles on PNKP

Similar Products

Product Notes

The PNKP pnkp (Catalog #AAA3235680) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PNKP Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PNKP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PNKP pnkp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALLSASPEVV VAVGFPGAGK STFLKKHLVS AGYVHVNRDT LGSWQRCVTT. It is sometimes possible for the material contained within the vial of "PNKP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.