Western Blot (WB)
(Western Blot detection against Immunogen (31.24kD).)
Mouse anti-Human RCE1 Monoclonal Antibody | anti-RCE1 antibody
RCE1 (CAAX Prenyl Protease 2, Prenyl Protein-specific Endoprotease 2, Farnesylated Proteins-converting Enzyme 2, FACE-2, RCE1 Homolog, hRCE1, FACE2, RCE1A, RCE1B) (FITC)
Gene Names
RCE1; FACE2; RCE1A; RCE1B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RCE1; Monoclonal Antibody; RCE1 (CAAX Prenyl Protease 2; Prenyl Protein-specific Endoprotease 2; Farnesylated Proteins-converting Enzyme 2; FACE-2; RCE1 Homolog; hRCE1; FACE2; RCE1A; RCE1B) (FITC); anti-RCE1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A6
Specificity
Recognizes human RCE1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1462
Applicable Applications for anti-RCE1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa133-182 from RCE1 (NP_005124) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (31.24kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (31.24kD).)
Related Product Information for anti-RCE1 antibody
RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.
Product Categories/Family for anti-RCE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens Ras converting CAAX endopeptidase 1 (RCE1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
Ras converting CAAX endopeptidase 1
NCBI Official Symbol
RCE1
NCBI Official Synonym Symbols
FACE2; RCE1A; RCE1B
NCBI Protein Information
CAAX prenyl protease 2
UniProt Protein Name
CAAX prenyl protease 2
UniProt Gene Name
RCE1
UniProt Synonym Gene Names
FACE2; RCE1A; RCE1B; FACE-2; hRCE1
UniProt Entry Name
FACE2_HUMAN
NCBI Description
This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq, Jul 2008]
Uniprot Description
RCE1: Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1. Belongs to the peptidase U48 family.
Protein type: EC 3.4.22.-; Membrane protein, multi-pass; Membrane protein, integral; Protease
Chromosomal Location of Human Ortholog: 11q13
Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to plasma membrane; membrane
Molecular Function: cysteine-type endopeptidase activity; endopeptidase activity; metalloendopeptidase activity
Biological Process: proteolysis
Research Articles on RCE1
Similar Products
Product Notes
The RCE1 rce1 (Catalog #AAA6149278) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RCE1 (CAAX Prenyl Protease 2, Prenyl Protein-specific Endoprotease 2, Farnesylated Proteins-converting Enzyme 2, FACE-2, RCE1 Homolog, hRCE1, FACE2, RCE1A, RCE1B) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RCE1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RCE1 rce1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RCE1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
