PER3 blocking peptide

PER3 Peptide - C-terminal region

Cat. Num. AAA3227121

• Gene Names: PER3; GIG13; FASPS3
• Reactivity: Human
• Applications: Western Blot
• Synonyms: PER3; PER3 Peptide - C-terminal region; PER3 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: DATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFRE
• Sequence Length: 1210

• Applicable Applications for PER3 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for PER3 blocking peptide

This is a synthetic peptide designed for use in combination with anti-PER3 Antibody, made

Target Description: This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known.

Product Categories/Family for PER3 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 317373535
• NCBI GeneID: 8863
• UniProt Accession #: P56645
• Molecular Weight: 133kDa
• NCBI Official Full Name: Period circadian protein homolog 3
• NCBI Official Synonym Full Names: period circadian regulator 3
• NCBI Official Symbol: PER3
• NCBI Official Synonym Symbols: GIG13; FASPS3
• NCBI Protein Information: period circadian protein homolog 3
• UniProt Protein Name: Period circadian protein homolog 3
• Protein Family: Period circadian protein
• UniProt Gene Name: PER3
• UniProt Synonym Gene Names: hPER3
• UniProt Entry Name: PER3_HUMAN

NCBI Description

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been linked to sleep disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2014]

Uniprot Description

PER3: Component of the circadian clock mechanism which is essential for generating circadian rhythms. Can bind heme. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 1p36.23

Cellular Component: cytoplasm; nucleus

Molecular Function: signal transducer activity; protein binding; ubiquitin protein ligase binding; kinase binding

Biological Process: transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; circadian regulation of gene expression; signal transduction; regulation of circadian sleep/wake cycle, sleep