Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PELI1 blocking peptide

PELI1 Peptide - middle region

Reactivity
Human
Synonyms
PELI1; PELI1 Peptide - middle region; PELI1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPY
Sequence Length
418
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PELI1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PELI1 Antibody, made

Target Description: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
Product Categories/Family for PELI1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase pellino homolog 1
NCBI Official Synonym Full Names
pellino E3 ubiquitin protein ligase 1
NCBI Official Symbol
PELI1
NCBI Protein Information
E3 ubiquitin-protein ligase pellino homolog 1
UniProt Protein Name
E3 ubiquitin-protein ligase pellino homolog 1
UniProt Gene Name
PELI1
UniProt Synonym Gene Names
PRISM; Pellino-1
UniProt Entry Name
PELI1_HUMAN

Uniprot Description

PELI1: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation. Found in a complex containing TRAF6, IRAK1 and IRAK4. Interacts with MAP3K7. Belongs to the pellino family.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Adaptor/scaffold; Ubiquitin conjugating system; Ligase; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: cytosol; nucleus

Molecular Function: protein binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: positive regulation of cytokine production; positive regulation of toll-like receptor 3 signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; response to dsRNA; positive regulation of toll-like receptor 4 signaling pathway; response to lipopolysaccharide; Toll signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; negative regulation of T cell proliferation; positive regulation of protein ubiquitination; inhibition of NF-kappaB transcription factor; positive regulation of B cell proliferation; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway

Research Articles on PELI1

Similar Products

Product Notes

The PELI1 peli1 (Catalog #AAA3246620) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PELI1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SMKRKDVVDE KQPWVYLNCG HVHGYHNWGN KEERDGKDRE CPMCRSVGPY. It is sometimes possible for the material contained within the vial of "PELI1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.