Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NCF2 blocking peptide

NCF2 Peptide - C-terminal region

Gene Names
NCF2; NCF-2; NOXA2; P67PHOX; P67-PHOX
Reactivity
Human
Applications
Western Blot
Synonyms
NCF2; NCF2 Peptide - C-terminal region; NCF2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF
Sequence Length
526
Applicable Applications for NCF2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NCF2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NCF2 Antibody, made

Target Description: This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms.
Product Categories/Family for NCF2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
neutrophil cytosol factor 2 isoform 1
NCBI Official Synonym Full Names
neutrophil cytosolic factor 2
NCBI Official Symbol
NCF2
NCBI Official Synonym Symbols
NCF-2; NOXA2; P67PHOX; P67-PHOX
NCBI Protein Information
neutrophil cytosol factor 2
UniProt Protein Name
Neutrophil cytosol factor 2
Protein Family
UniProt Gene Name
NCF2
UniProt Synonym Gene Names
NOXA2; P67PHOX; NCF-2
UniProt Entry Name
NCF2_HUMAN

NCBI Description

This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010]

Uniprot Description

p67phox: NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production). Interacts with SYTL1 and RAC1. Interacts with NCF4. May interact with NOXO1. Belongs to the NCF2/NOXA1 family.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: cytoplasm; nucleolus; acrosome; cytosol; NADPH oxidase complex

Molecular Function: protein C-terminus binding; protein binding; electron carrier activity; Rac GTPase binding

Biological Process: respiratory burst; response to drug; interaction with host; superoxide metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; response to lipopolysaccharide; cellular response to hormone stimulus; antigen processing and presentation of peptide antigen via MHC class I; response to hyperoxia; positive regulation of neuron apoptosis; response to glucose stimulus; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; cellular defense response; response to activity; response to progesterone stimulus; vascular endothelial growth factor receptor signaling pathway; superoxide release; positive regulation of blood pressure; aging

Disease: Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-positive, Type Ii

Research Articles on NCF2

Similar Products

Product Notes

The NCF2 ncf2 (Catalog #AAA3241281) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NCF2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCF2 ncf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TVGDQGFPDE PKESEKADAN NQTTEPQLKK GSQVEALFSY EATQPEDLEF. It is sometimes possible for the material contained within the vial of "NCF2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.