Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HLTF blocking peptide

HLTF Peptide - middle region

Gene Names
HLTF; ZBU1; HLTF1; RNF80; HIP116; SNF2L3; HIP116A; SMARCA3
Reactivity
Human
Synonyms
HLTF; HLTF Peptide - middle region; HLTF blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DVLGLLLRLRQICCHTYLLTNAVSSNGPSGNDTPEELRKKLIRKMKLILS
Sequence Length
1009
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HLTF blocking peptide
This is a synthetic peptide designed for use in combination with anti- HLTF Antibody, made

Target Description: This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.
Product Categories/Family for HLTF blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110 kDa
NCBI Official Full Name
helicase-like transcription factor isoform 1
NCBI Official Synonym Full Names
helicase like transcription factor
NCBI Official Symbol
HLTF
NCBI Official Synonym Symbols
ZBU1; HLTF1; RNF80; HIP116; SNF2L3; HIP116A; SMARCA3
NCBI Protein Information
helicase-like transcription factor
UniProt Protein Name
Helicase-like transcription factor
UniProt Gene Name
HLTF
UniProt Synonym Gene Names
HIP116A; RNF80; SMARCA3; SNF2L3; ZBU1

NCBI Description

This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. [provided by RefSeq, Jul 2008]

Uniprot Description

SMARCA3: an enzyme with apparent ATP-dependent DNA helicase activity. Belongs to the SNF2/RAD54 helicase family, RAD16 subfamily. Two alternatively spliced human isoforms have been described.

Protein type: DNA-binding; EC 3.6.1.-; EC 3.6.4.-; EC 6.3.2.-; EC 6.3.2.19; Helicase; Ligase; Nucleolus; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 3q24

Cellular Component: membrane; nucleoplasm; nucleus

Molecular Function: DNA binding; protein binding; ubiquitin protein ligase binding

Biological Process: regulation of transcription, DNA-dependent

Research Articles on HLTF

Similar Products

Product Notes

The HLTF hltf (Catalog #AAA3244370) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HLTF Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVLGLLLRLR QICCHTYLLT NAVSSNGPSG NDTPEELRKK LIRKMKLILS. It is sometimes possible for the material contained within the vial of "HLTF, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.