Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HLTFSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HLTF Polyclonal Antibody | anti-HLTF antibody

HLTF Antibody - middle region

Gene Names
HLTF; ZBU1; HLTF1; RNF80; HIP116; SNF2L3; HIP116A; SMARCA3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HLTF; Polyclonal Antibody; HLTF Antibody - middle region; anti-HLTF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVLGLLLRLRQICCHTYLLTNAVSSNGPSGNDTPEELRKKLIRKMKLILS
Sequence Length
1009
Applicable Applications for anti-HLTF antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HLTF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HLTFSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HLTFSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HLTF antibody
This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110 kDa
NCBI Official Full Name
helicase-like transcription factor isoform 1
NCBI Official Synonym Full Names
helicase like transcription factor
NCBI Official Symbol
HLTF
NCBI Official Synonym Symbols
ZBU1; HLTF1; RNF80; HIP116; SNF2L3; HIP116A; SMARCA3
NCBI Protein Information
helicase-like transcription factor
UniProt Protein Name
Helicase-like transcription factor
UniProt Gene Name
HLTF
UniProt Synonym Gene Names
HIP116A; RNF80; SMARCA3; SNF2L3; ZBU1

NCBI Description

This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. [provided by RefSeq, Jul 2008]

Uniprot Description

SMARCA3: an enzyme with apparent ATP-dependent DNA helicase activity. Belongs to the SNF2/RAD54 helicase family, RAD16 subfamily. Two alternatively spliced human isoforms have been described.

Protein type: DNA-binding; EC 3.6.1.-; EC 3.6.4.-; EC 6.3.2.-; EC 6.3.2.19; Helicase; Ligase; Nucleolus; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 3q24

Cellular Component: membrane; nucleoplasm; nucleus

Molecular Function: DNA binding; protein binding; ubiquitin protein ligase binding

Biological Process: regulation of transcription, DNA-dependent

Research Articles on HLTF

Similar Products

Product Notes

The HLTF hltf (Catalog #AAA3219491) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLTF Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HLTF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HLTF hltf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVLGLLLRLR QICCHTYLLT NAVSSNGPSG NDTPEELRKK LIRKMKLILS. It is sometimes possible for the material contained within the vial of "HLTF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.