GAS8 blocking peptide
GAS8 Peptide - N-terminal region
Gene Names
GAS8; DRC4; GAS11; CILD33
Reactivity
Human
Applications
Western Blot
Synonyms
GAS8; GAS8 Peptide - N-terminal region; GAS8 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM
Sequence Length
478
Applicable Applications for GAS8 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GAS8 blocking peptide
This is a synthetic peptide designed for use in combination with anti-GAS8 Antibody, made
Target Description: This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.
Target Description: This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.
Product Categories/Family for GAS8 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
dynein regulatory complex subunit 4 isoform a
NCBI Official Synonym Full Names
growth arrest specific 8
NCBI Official Symbol
GAS8
NCBI Official Synonym Symbols
DRC4; GAS11; CILD33
NCBI Protein Information
dynein regulatory complex subunit 4; growth arrest-specific protein 8
UniProt Protein Name
Growth arrest-specific protein 8
Protein Family
UniProt Gene Name
GAS8
UniProt Synonym Gene Names
GAS11; GAS-8; GAS-11
UniProt Entry Name
GAS8_HUMAN
NCBI Description
This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]
Research Articles on GAS8
Similar Products
Product Notes
The GAS8 gas8 (Catalog #AAA3233788) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GAS8 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAS8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GAS8 gas8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VSRIREELDR EREERNYFQL ERDKIHTFWE ITRRQLEEKK AELRNKDREM. It is sometimes possible for the material contained within the vial of "GAS8, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
