Immunohistochemistry (IHC)
(Sample Type: Human nasal epithelialApplication: IHCSpecies+tissue/cell type:Species+tissue/cell type: Human nasal epithelial cellsPrimary antibody dilution: 1:1200Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000)
Rabbit GAS8 Polyclonal Antibody | anti-GAS8 antibody
GAS8 antibody - middle region
Gene Names
GAS8; DRC4; GAS11; CILD33
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GAS8; Polyclonal Antibody; GAS8 antibody - middle region; anti-GAS8 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK
Sequence Length
478
Applicable Applications for anti-GAS8 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GAS8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type: Human nasal epithelialApplication: IHCSpecies+tissue/cell type:Species+tissue/cell type: Human nasal epithelial cellsPrimary antibody dilution: 1:1200Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000)
Immunohistochemistry (IHC)
(Sample Type: Human nasal epithelialApplication: IHCSpecies+tissue/cell type:Species+tissue/cell type: Human nasal epithelial cellsPrimary antibody dilution: 1:1200Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000)
Western Blot (WB)
(WB Suggested Anti-GAS8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-GAS8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-GAS8 antibody
This is a rabbit polyclonal antibody against GAS8. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.
Target Description: This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.
Product Categories/Family for anti-GAS8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
dynein regulatory complex subunit 4 isoform a
NCBI Official Synonym Full Names
growth arrest specific 8
NCBI Official Symbol
GAS8
NCBI Official Synonym Symbols
DRC4; GAS11; CILD33
NCBI Protein Information
dynein regulatory complex subunit 4; growth arrest-specific protein 8
UniProt Protein Name
Growth arrest-specific protein 8
Protein Family
UniProt Gene Name
GAS8
UniProt Synonym Gene Names
GAS11; GAS-8; GAS-11
UniProt Entry Name
GAS8_HUMAN
NCBI Description
This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]
Research Articles on GAS8
Similar Products
Product Notes
The GAS8 gas8 (Catalog #AAA3208824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAS8 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GAS8 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GAS8 gas8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RALKVELKEQ ELASEVVVKN LRLKHTEEIT RMRNDFERQV REIEAKYDKK. It is sometimes possible for the material contained within the vial of "GAS8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
