FBXL12 blocking peptide
FBXL12 Peptide - C-terminal region
Gene Names
FBXL12; Fbl12
Reactivity
Human
Applications
Western Blot
Synonyms
FBXL12; FBXL12 Peptide - C-terminal region; FBXL12 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE
Sequence Length
326
Applicable Applications for FBXL12 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FBXL12 blocking peptide
This is a synthetic peptide designed for use in combination with anti-FBXL12 Antibody, made
Target Description: Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).
Target Description: Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).
Product Categories/Family for FBXL12 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
F-box/LRR-repeat protein 12 isoform a
NCBI Official Synonym Full Names
F-box and leucine rich repeat protein 12
NCBI Official Symbol
FBXL12
NCBI Official Synonym Symbols
Fbl12
NCBI Protein Information
F-box/LRR-repeat protein 12
UniProt Protein Name
F-box/LRR-repeat protein 12
UniProt Gene Name
FBXL12
UniProt Synonym Gene Names
FBL12
UniProt Entry Name
FXL12_HUMAN
NCBI Description
Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Research Articles on FBXL12
Similar Products
Product Notes
The FBXL12 fbxl12 (Catalog #AAA3239262) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FBXL12 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBXL12 fbxl12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PTEILSSCLT MPKLRVLELQ GLGWEGQEAE KILCKGLPHC MVIVRACPKE. It is sometimes possible for the material contained within the vial of "FBXL12, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
