Mouse anti-Human IL13 Monoclonal Antibody | anti-IL13 antibody

IL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (PE)

Cat. Num. AAA6158354

• Gene Names: IL13; P600; IL-13
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL13; Monoclonal Antibody; IL13 (Interleukin-13; Interleukin 13; NC30; IL-13; MGC116786; MGC116788; MGC116789) (PE); anti-IL13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H7
• Specificity: Recognizes human IL13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 146

• Applicable Applications for anti-IL13 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-146 from human IL13 (NP_002179) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.32kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IL13 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Product Categories/Family for anti-IL13 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 26787978
• NCBI GeneID: 3596
• NCBI Accession #: NP_002179
• NCBI GenBank Nucleotide #: NP_002179.2
• UniProt Accession #: P35225
• NCBI Official Full Name: interleukin-13 isoform 1
• NCBI Official Synonym Full Names: interleukin 13
• NCBI Official Symbol: IL13
• NCBI Official Synonym Symbols: P600; IL-13
• NCBI Protein Information: interleukin-13
• UniProt Protein Name: Interleukin-13
• Protein Family: Interleukin
• UniProt Gene Name: IL13
• UniProt Synonym Gene Names: NC30; IL-13
• UniProt Entry Name: IL13_HUMAN

NCBI Description

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008]

Uniprot Description

IL13: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Defects in IL13 may be a cause of susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure. Belongs to the IL-4/IL-13 family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: extracellular space; cytoplasm; extracellular region; external side of plasma membrane

Molecular Function: protein binding; interleukin-13 receptor binding; cytokine activity

Biological Process: response to nicotine; positive regulation of smooth muscle cell proliferation; microglial cell activation; regulation of proton transport; response to lipopolysaccharide; signal transduction; positive regulation of connective tissue growth factor production; positive regulation of tyrosine phosphorylation of Stat6 protein; positive regulation of immunoglobulin production; response to ethanol; cell-cell signaling; positive regulation of protein secretion; positive regulation of B cell proliferation; immune response; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of NAD(P)H oxidase activity; inflammatory response; cell motility; positive regulation of macrophage activation

Disease: Asthma, Susceptibility To; Allergic Rhinitis