Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNPH1 blocking peptide

DNPH1 Peptide - N-terminal region

Gene Names
DNPH1; RCL; C6orf108; dJ330M21.3
Reactivity
Human
Synonyms
DNPH1; DNPH1 Peptide - N-terminal region; DNPH1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVL
Sequence Length
174
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DNPH1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DNPH1 Antibody, made

Target Description: This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described.
Product Categories/Family for DNPH1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
2'-deoxynucleoside 5'-phosphate N-hydrolase 1 isoform 1
NCBI Official Synonym Full Names
2'-deoxynucleoside 5'-phosphate N-hydrolase 1
NCBI Official Symbol
DNPH1
NCBI Official Synonym Symbols
RCL; C6orf108; dJ330M21.3
NCBI Protein Information
2'-deoxynucleoside 5'-phosphate N-hydrolase 1
UniProt Protein Name
2'-deoxynucleoside 5'-phosphate N-hydrolase 1
UniProt Gene Name
DNPH1
UniProt Synonym Gene Names
C6orf108; RCL
UniProt Entry Name
DNPH1_HUMAN

NCBI Description

This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

DNPH1: Catalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5- phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'- monophosphates containing purine bases are preferred to those containing pyrimidine bases. Monomer and homodimer. Expression is induced by ETV1. Expressed at low levels in brain, colon, lung, peripheral blood leukocytes, placenta, small intestine, and thymus. Expressed at high levels in heart, kidney, liver, skeletal muscle and spleen. Overexpressed in a significant proportion of breast cancers. Belongs to the deoxyribonucleoside 5'-monophosphate N- glycosidase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.2.2.-; Hydrolase

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein homodimerization activity; nucleoside deoxyribosyltransferase activity

Biological Process: cell proliferation; epithelial cell differentiation; nucleoside metabolic process; nucleotide metabolic process; positive regulation of cell growth; deoxyribonucleoside monophosphate catabolic process

Research Articles on DNPH1

Similar Products

Product Notes

The DNPH1 dnph1 (Catalog #AAA3244840) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DNPH1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMVPGRSESW ERGEPGRPAL YFCGSIRGGR EDRTLYERIV SRLRRFGTVL. It is sometimes possible for the material contained within the vial of "DNPH1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.